Recombinant Human TYRO protein tyrosine kinase-binding protein (TYROBP)

Shipped with Ice Packs
In Stock

Description

Neurodegenerative Diseases

  • Alzheimer’s Disease (AD): TYROBP forms a complex with TREM2 to regulate microglial phagocytosis and inflammatory responses. In Tyrobp-deficient APP/PSEN1 mice, amyloid plaque density decreased by ~30%, accompanied by reduced neuroinflammation . Conversely, transgenic overexpression in microglia exacerbated tau phosphorylation but improved cognitive function in tauopathy models .

  • Nasu-Hakola Disease: Mutations in TYROBP cause this rare dementia, characterized by bone cysts and neurodegeneration. Recombinant TYROBP aids in studying ITAM-dependent signaling defects .

Cancer Immunology

  • Osteosarcoma: High TYROBP expression correlates with prolonged survival (P < 0.001) and enhanced antitumor immunity. It promotes immune cell infiltration (immune score: R = 0.87) and activates pathways like NF-κB and cytokine signaling .

  • Renal Cell Carcinoma: TYROBP modulates inflammatory responses, influencing tumor microenvironment dynamics .

Bone Remodeling

TYROBP-TREM2 signaling in osteoclasts is essential for bone resorption. Knockout models show impaired osteoclast multinucleation and skeletal abnormalities .

Key Research Findings

Study FocusModel SystemOutcomeSource
Alzheimer’s pathologyAPP/PSEN1; Tyrobp⁻/⁻ miceReduced amyloid plaques and microglial clustering
TauopathyMAPT P301S; Tyrobp transgenic miceIncreased tau phosphorylation but improved cognition
Osteosarcoma prognosisHuman patient cohortsHigh TYROBP linked to better survival (HR = 0.45)
Immune signalingIn vitro macrophage assaysTYROBP required for CR3-mediated ROS production

Applications in Biotechnology

  • Antibody Development: Recombinant TYROBP serves as an immunogen for antibodies like Proteintech’s 28138-1-AP, which detects endogenous TYROBP at 10–12 kDa in WB .

  • Drug Screening: Used to identify modulators of TREM2-TYROBP interactions, a therapeutic target for AD .

  • Structural Studies: The E. coli-derived protein (40 kDa) facilitates crystallography and epitope mapping .

Challenges and Future Directions

While recombinant TYROBP has advanced mechanistic studies, discrepancies in molecular weight across systems (e.g., 9.3 kDa vs. 40 kDa) highlight the impact of tags and post-translational modifications . Future work should standardize production protocols and explore isoform-specific functions (e.g., transcript variants 1 and 2) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for the specific delivery time.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TYROBP; DAP12; KARAP; TYRO protein tyrosine kinase-binding protein; DNAX-activation protein 12; Killer-activating receptor-associated protein; KAR-associated protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-113
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
LRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
Uniprot No.

Target Background

Function
TYROBP, also known as DAP12, is an adapter protein that non-covalently associates with activating receptors on the surface of various immune cells. This association mediates signaling and cell activation following ligand binding by these receptors. Upon ligand binding, the ITAM domain within TYROBP undergoes tyrosine phosphorylation, leading to the activation of additional tyrosine kinases and subsequent cell activation. TYROBP also plays an inhibitory role in some cells. It forms non-covalent associations with activating receptors of the CD300 family, the CD200R family, and integrins to regulate cell activation. Specifically, TYROBP is essential for neutrophil activation mediated by integrins, myeloid cell activation mediated by the CLEC5A/MDL1 receptor, and NK cell activation through association with KIR2DS2 and the KLRD1/KLRC2 heterodimer. Moreover, TYROBP enhances trafficking and cell surface expression of NK cell receptors KIR2DS1, KIR2DS2, and KIR2DS4, ensuring their stability at the cell surface. TYROBP also associates with SIRPB1 to mediate activation of myeloid cells like monocytes and dendritic cells, with TREM1 to mediate activation of neutrophils and monocytes, and with TREM2 on monocyte-derived dendritic cells to mediate upregulation of CCR7, dendritic cell maturation, and survival. The association with TREM2 also mediates cytokine-induced formation of multinucleated giant cells through macrophage fusion. TYROBP stabilizes the TREM2 C-terminal fragment (TREM2-CTF) produced by TREM2 ectodomain shedding, which suppresses the release of pro-inflammatory cytokines. In microglia, TYROBP is required alongside TREM2 for phagocytosis of apoptotic neurons and alongside ITGAM/CD11B to control the production of microglial superoxide ions, promoting neuronal apoptosis during brain development. TYROBP promotes pro-inflammatory responses in microglia following nerve injury, accelerating the degeneration of injured neurons. It positively regulates the expression of the IRAK3/IRAK-M kinase and IL10 production by liver dendritic cells, inhibiting their T cell allostimulatory ability. TYROBP negatively regulates B cell proliferation and is required for CSF1-mediated osteoclast cytoskeletal organization. Finally, it positively regulates multinucleation during osteoclast development.
Gene References Into Functions
  1. Heterozygous carriership of the TYROBP deletion is not a significant risk factor for cognitive impairment. PMID: 29336840
  2. Mutations in TYROBP are not a common cause of dementia in this Turkish cohort. PMID: 28716534
  3. Rare TYROBP variants might contribute to early-onset Alzheimer's disease risk by reducing TREM2 expression, a well-established risk factor for AD. PMID: 27658901
  4. TYROBP influences a set of genes related to Alzheimer's disease; ZNF329 and RB1 significantly regulate those 'mesenchymal' gene expression signature genes for brain tumors. Using gene expression data, Context Based Dependency Network (CBDN) can efficiently infer gene-gene interactions and their regulatory directions. PMID: 27556418
  5. The TYROBP/CSTA gene interaction might play crucial roles in the occurrence and development of Postmenopausal Osteoporosis PMID: 26676054
  6. The distinct expression of DAP12 compared to TREM2 provides the first evidence of such variable expressivity in Nasu-Hakola disease (NHD) microglia. PMID: 26001891
  7. The microglial membrane adapter protein DAP12 is essential for both nerve injury- and intrathecal CSF1-induced upregulation of pain-related microglial genes and the subsequent pain, but not for microglial proliferation PMID: 26642091
  8. Impaired signaling by the TREM2-DAP12 pathway leads to altered immune responses in phagocytosis, cytokine production, and microglial proliferation and survival, contributing to disease pathogenesis. Review. PMID: 26337043
  9. T cells engineered to express a KIR-CAR and DAP12 exhibit superior antitumor activity compared with standard first- and second-generation CD3zeta-based CARs in a xenograft model of mesothelioma highly resistant to immunotherapy. PMID: 25941351
  10. This study revealed that TYROBP plays a central role in the manifestation of bipolar disease and schizophrenia. PMID: 25487697
  11. Isolated PMNs have an increased proportion of both TREM1 and DAP12 compared to normal healthy controls PMID: 25642940
  12. Results support a role of DAP12 in stabilizing TREM2-CTF, thereby protecting against excessive pro-inflammatory responses. PMID: 25957402
  13. Mutations in TYROBP are a known genetic cause of Nasu-Hakola disease. PMID: 24612676
  14. Data indicate that the NKG2 receptor NKG2E can associate with CD94 and DAP12, but the complex is retained intracellularly at the endoplasmic reticulum. PMID: 24935923
  15. Macrophage traits in BRC cells facilitate the metastatic process, and DAP12 expression might promote metastatic homing to bone and liver tissues. PMID: 23810293
  16. DAP12 plays a role in trafficking newly synthesized KIR to the cell surface. It interacts with an immature KIR2DS isoform, likely initiating in the ER. DAP12 also impacts KIR2DS surface stability. PMID: 23715743
  17. Dynamics and dimerization of the TM helix of DAP12 in the membrane bilayer PMID: 23561520
  18. A molecular defect of DAP12 in human monocytes deregulates the gene network crucial for maintaining myeloid cell function in Nasu-Hakola disease. PMID: 22080356
  19. The putative periodontal pathogen P. gingivalis can positively regulate the expression of the TREM-1/DAP12 pathway in monocytic cells. PMID: 21967868
  20. DAP12 gene levels were not elevated in the monocytes of schizophrenic, bipolar, or major depressive disorder patients. PMID: 21421043
  21. Data suggest that OSCAR is a collagen receptor that binds to specific collagen motifs and costimulates osteoclastogenesis in DAP12-deficient humans and mice. PMID: 21841309
  22. A transgenic mouse model demonstrates that the induction of tolerance in Ly49H-positive natural killer (NK) cells by chronic exposure to virus-encoded ligand m157 requires signaling through the Ly49H adaptor protein DAP12, not the DAP10 adaptor protein. PMID: 21263069
  23. Meta-analysis of gene-disease association. (HuGE Navigator) PMID: 20628624
  24. These findings indicate that DAP12, potentially through association with TREM2, contributes to alveolar macrophage chemotaxis and recruitment to the lung, and may mediate macrophage accumulation in lung diseases like emphysema. PMID: 20421649
  25. The MDL-1 receptor, a DAP12-associating lectin, is a key regulator of synovial injury and bone erosion in autoimmune joint inflammation. PMID: 20212065
  26. Mutations in two genes encoding different subunits of a receptor signaling complex (TYROBP and TREM2) result in an identical disease phenotype PMID: 12080485
  27. Myeloid abnormalities observed in KARAP/DAP12-transgenic mice indicate that KARAP/DAP12-driven signals are involved in inflammation and constitute an essential target to control the resolution of inflammatory disorders based on monocytes/macrophages and neutrophils. PMID: 12207350
  28. DAP12 plays a role in signal transduction, bone modeling, and brain myelination [review] PMID: 12569153
  29. CD158j in T cells functions as a costimulatory molecule through the JNK pathway independent of KARAP/DAP12 and DAP10. PMID: 12591902
  30. These results indicate an important role for DAP12-TREM2 signaling complex in the differentiation and function of osteoclasts. PMID: 12925681
  31. DAP12 association with the natural cytotoxicity receptor NKp44 is required for activating properties and surface expression of NKp44 in natural killer (NK) cells. PMID: 14707061
  32. In clones that lack expression of KARAP/DAP12, stimulation of killer Ig-receptor KIR2DS2 does not induce cytotoxicity, whereas expression of KARAP/DAP12 is sufficient to convert a costimulatory KIR receptor into a stimulatory molecule. PMID: 15356118
  33. Splenic mature dendritic cells from transgenic mice with DAP12 overexpression are characterized by an impaired tolerogenic potential PMID: 16206234
  34. Activated and expanded CD8+ T cells require DAP12 for direct killing PMID: 16339517
  35. Nasu-Hakola disease due to a DAP12 mutation 4. PMID: 16505336
  36. This review discusses the dual functionality of DAP12 and presents evidence that DAP12 can suppress as well as activate natural killer (NK) cells. PMID: 17100880
  37. This is the first case of Nasu-Hakola disease caused by compound heterozygosity for loss-of-function mutations in DAP12. PMID: 17125796
  38. KIR3DS1 associates with the ITAM-bearing adaptor, DAP12 PMID: 17202323
  39. Activation signals delivered via DAP12 can be counterbalanced by the adaptor NTAL PMID: 17277102
  40. Transcript analysis of DCs of PLOSL patients shows that DAP12 deficient cells differentiated into DCs and responded to pathogenic stimuli. However, the DCs showed morphological differences due to defects in the actin filaments. PMID: 17530208
  41. The DAP12-TREM2 complex is unlikely to play a role in the genetic susceptibility of multiple sclerosis PMID: 19019460
  42. Downstream targets of DAP10 and DAP12 are constitutively activated in large granular lymphocyte leukemia cells, and expression of dominant-negative DAP10 and DAP12 dramatically reduces their lytic capacity. PMID: 19075187
  43. Loss of function mutation results in a recessive genetic disorder, Nasu-Hakola disease (bone development abnormalities and dementia at adolescence) PMID: 19120482
  44. Describe the generation and characterization of an anti-DAP12 monoclonal antibody. Using this novel reagent, we show that DAP12 expression is restricted to innate immune cells in basal conditions PMID: 19606219

Show More

Hide All

Database Links

HGNC: 12449

OMIM: 221770

KEGG: hsa:7305

STRING: 9606.ENSP00000262629

UniGene: Hs.515369

Involvement In Disease
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL)
Protein Families
TYROBP family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed at low levels in the early development of the hematopoietic system and in the promonocytic stage and at high levels in mature monocytes. Expressed in hematological cells and tissues such as peripheral blood leukocytes and spleen. Also found in b

Q&A

What is TYROBP and what cellular functions does it mediate?

TYROBP is a transmembrane signaling polypeptide that contains an immunoreceptor phospho-tyrosine-based activation motif (ITAM) in its cytoplasmic domain. It is expressed in microglia and serves as an adaptor for a variety of immune receptors, including two molecules closely linked to Alzheimer's disease (AD) pathogenesis: TREM2 (triggering receptor expressed on myeloid cells 2) and CR3 (complement receptor 3) . Functionally, TYROBP plays a central role in the microglial sensome, helping these cells sense changes in their environment and respond to injury, microbial invasion, or accumulation of abnormal proteins like amyloid-β . It facilitates signal transduction downstream of multiple receptors, regulating microglial activation, phagocytosis, and inflammatory responses.

How does TYROBP relate to neurodegenerative disease pathology?

TYROBP has been identified by computational transcriptomics as a network hub and driver in late-onset sporadic Alzheimer's disease (AD) and as an important regulator of the microglial environmental sensing function . Genetic variants of TYROBP have been identified in early-onset AD , and most TYROBP mutations represent loss-of-function mutations that result in Nasu-Hakola disease, a rare form of dementia .

Research using transgenic mice overexpressing TYROBP in microglia shows differential effects on AD-related pathologies - when crossed with APP/PSEN1 mice (an amyloid model), there was a decrease in amyloid burden, but when crossed with MAPT P301S mice (a tau model), there was an increase in tau phosphorylation . These findings indicate that TYROBP can modulate both amyloid and tau pathologies, the two major hallmarks of AD.

What is the relationship between TYROBP and TREM2?

While TYROBP serves as the transmembrane adaptor for TREM2, their relationship is more complex than a simple linear pathway. TYROBP-APOE signaling in the microglial sensome operates independently of Trem2 . Studies using Trem2-null mice demonstrate that upregulation of Tyrobp and Apoe does not require Trem2, but interestingly, upregulation of microglial Apoe requires Tyrobp to reach normal levels .

This supports a model where Tyrobp and Apoe transcripts are increased first in the process of microglial activation, and neither transcriptional event requires the presence of Trem2 . This suggests TYROBP may function upstream of or parallel to TREM2 in some signaling contexts, highlighting its potential as an independent therapeutic target.

How does TYROBP expression change in recruited versus resident microglia?

Using dual RNA in situ hybridization and immunohistochemistry techniques, researchers have observed that Tyrobp mRNA levels are significantly increased specifically in recruited microglia in wild-type mice and AD-related mouse models . In mouse models of cerebral amyloidosis (APP/PSEN1 and 5xFAD), Tyrobp mRNA levels are extensively and selectively increased in microglia recruited in close proximity to amyloid plaques compared to microglia more distant from plaques .

Interestingly, when primary microglia from wild-type mice were activated with lipopolysaccharide (LPS) in culture, Tyrobp mRNA levels remained unchanged despite robust activation as measured by Tnfα expression . This suggests that Tyrobp transcription may be increased only when microglia are both recruited and activated but not in resident microglia that are activated alone . This distinction is crucial for understanding the specific roles of TYROBP in different microglial populations and activation states.

What mechanisms underlie TYROBP-mediated modification of amyloid and tau pathology?

Transgenic overexpression of TYROBP in microglia results in a decrease of amyloid burden in APP/PSEN1 mice and an increase of TAU phosphorylation in MAPT P301S mice . The mechanisms underlying these differential effects involve modulation of Apolipoprotein E (Apoe) transcription and associated pathways.

TYROBP overexpression alters the transcription of Apoe and associated genes, including Axl, Ccl2, Tgfβ, and Il6 . This transcriptional reprogramming affects microglial phenotype and function, potentially enhancing phagocytosis of amyloid-β while simultaneously promoting an inflammatory environment that may exacerbate tau pathology. The data confirm that TYROBP overexpression in microglia is sufficient to alter both amyloidosis and tauopathy phenotypes, making it a potential dual-edged therapeutic target in neurodegenerative diseases .

What is the role of TYROBP in the Disease-Associated Microglia (DAM) transition?

TYROBP has been implicated in the transition of homeostatic microglia to a Disease-Associated Microglia (DAM) state. According to the model proposed by Keren-Shaul et al., Tyrobp upregulation occurs in an early TREM2-independent phase (Stage 1) of DAM transition, alongside Apoe upregulation .

This early TREM2-independent phase was not evident in all studies, highlighting the complexity of the DAM transition process . Some researchers suggest that APOE drives the DAM transition through a TREM2-APOE pathway, while others suggest more complex regulatory interactions . The discrepancies across various analyses might be explained by the fact that DAM microglia are located in the immediate proximity of plaques, and neither bulk- nor single-cell-RNA sequencing can fully distinguish homeostatic vs DAM phenotypes since both techniques generate an average transcriptome analysis from all microglia in a given tissue sample . This limitation emphasizes the importance of spatial transcriptomics and in situ approaches for studying microglial heterogeneity.

How does TYROBP function in non-CNS contexts?

Beyond its roles in microglia, TYROBP has been identified in TYROBP-positive endothelial cells (ECs) that exhibit strong crosstalk with malignant cells in tumors . Patients with highly enriched TYROBP-positive ECs show higher immune scores indicative of a "hot" tumor state, with increased numbers of activated CD4+ T cells, CD8+ T cells, and natural killer cells .

TYROBP-positive ECs are associated with significantly activated chemokine, T cell receptor, B cell receptor, and Nod-like receptor signaling pathways . These cells express higher levels of classical immune checkpoint inhibitors (ICIs) such as CD276 and CD274 . Differential gene expression analysis identified 213 genes that vary between patients with different levels of TYROBP-positive EC enrichment, with cytokine-cytokine receptor interaction being the most enriched pathway . This suggests that TYROBP plays important roles in immune regulation beyond the CNS, potentially offering insights into its fundamental biological functions.

What are the recommended techniques for studying TYROBP expression in microglia?

For studying TYROBP expression in microglia, dual RNA in situ hybridization combined with immunohistochemistry has proven particularly valuable . This approach allows researchers to visualize Tyrobp mRNA levels specifically in microglia (identified by IBA1 immunostaining), while preserving spatial information about microglial location relative to pathological features like amyloid plaques or regions of tau pathology .

When implementing this technique:

  • Use RNAscope® for RNA in situ hybridization of Tyrobp mRNA

  • Combine with immunohistochemistry for microglial markers like IBA1

  • Include appropriate controls to distinguish between recruited and resident microglia

  • Consider triple-labeling approaches to simultaneously visualize Tyrobp, microglial markers, and pathological features (amyloid plaques or phosphorylated tau)

This method overcomes limitations of bulk tissue or single-cell RNA sequencing, which cannot distinguish homeostatic vs. disease-associated microglia based on their proximity to pathological features .

How can transgenic mouse models be used to study TYROBP function?

To study the effects of elevated TYROBP on microglial phenotype and AD pathogenesis, researchers have generated transgenic mice overexpressing TYROBP specifically in microglia . The Iba1-Tyrobp mouse model uses the Iba1 promoter to drive overexpression of a mouse Tyrobp transgene in microglia .

When designing similar transgenic approaches:

  • Select an appropriate promoter for cell-type specificity (e.g., Iba1 for microglia)

  • Consider the timing of expression (constitutive vs. inducible)

  • Cross with disease models to assess impact on pathology (e.g., APP/PSEN1 for amyloidosis or MAPT P301S for tauopathy)

  • Include comprehensive phenotyping:

    • Histological assessment of pathological features

    • Transcriptional profiling of microglia

    • Behavioral testing to assess functional outcomes

This approach allows for the assessment of TYROBP's causal role in disease processes, rather than merely correlative associations.

What experimental approaches can differentiate TYROBP-dependent from TREM2-dependent signaling?

To differentiate TYROBP-dependent from TREM2-dependent signaling pathways, researchers have employed several complementary approaches:

  • Genetic models with differential expression:

    • Study Tyrobp expression in Trem2-null mice around amyloid plaques or cortical stab injuries

    • Examine Apoe expression in both Trem2-null and Tyrobp-null mice

    • Compare phenotypes of Tyrobp-overexpressing mice with those of Trem2-overexpressing mice

  • Target-specific manipulations:

    • Use cortical stab injury models to induce microglial recruitment independent of AD pathology

    • Compare microglial activation profiles in different contexts (recruitment vs. LPS activation)

  • Sequential analysis:

    • Study temporal dynamics of gene expression during microglial activation

    • Identify early vs. late transcriptional changes in response to stimuli

These approaches have revealed that upregulation of Tyrobp and Apoe does not require Trem2, but that upregulation of microglial Apoe requires Tyrobp to reach normal levels . This suggests a hierarchical relationship where TYROBP functions either upstream of or parallel to TREM2 in regulating microglial phenotypes.

What analytical approaches are recommended for transcriptomic studies of TYROBP?

When conducting transcriptomic studies involving TYROBP, several analytical considerations are important:

  • Spatial resolution is critical:

    • Bulk RNA sequencing may miss important spatial relationships

    • Single-cell RNA sequencing should be complemented with spatial techniques

    • Consider dual RNA in situ hybridization to preserve spatial context

  • Pathway analysis:

    • Focus on networks rather than individual genes

    • Examine TYROBP-associated pathways like APOE signaling

    • Look for enrichment of pathways like cytokine-cytokine receptor interactions

  • Temporal dynamics:

    • Study early vs. late transcriptional changes

    • Consider the sequential activation of genes during microglial activation

    • Separate recruitment from activation signals

  • Integration with protein-level data:

    • Confirm mRNA changes at the protein level

    • Assess post-translational modifications that may affect TYROBP signaling

    • Consider protein-protein interaction networks

These analytical approaches have revealed TYROBP as a central player in microglial activation networks and as a potential therapeutic target in neurodegenerative diseases.

How might targeting TYROBP affect different aspects of neurodegeneration?

Targeting TYROBP for therapeutic intervention presents both opportunities and challenges given its differential effects on amyloid and tau pathology. The data from transgenic mice show that TYROBP overexpression reduces amyloid burden in APP/PSEN1 mice but increases tau phosphorylation in MAPT P301S mice .

This suggests that:

  • TYROBP modulation might be beneficial in early Alzheimer's disease stages dominated by amyloid pathology

  • The same approach might exacerbate disease in later stages when tau pathology predominates

  • Temporal control of TYROBP modulation might be necessary for optimal therapeutic effects

  • Combination approaches targeting both TYROBP and tau-related pathways might be required

Understanding the precise molecular mechanisms by which TYROBP affects these pathologies will be crucial for designing targeted interventions that maximize benefits while minimizing potential adverse effects.

What biomarker potential does TYROBP have in neurodegenerative diseases?

TYROBP upregulation appears to be an early marker of recruited microglia in various contexts, including around amyloid plaques, in areas of tau pathology, and at sites of injury . This suggests potential applications as a biomarker for:

  • Microglial activation in neuroinflammatory conditions

  • Disease progression in Alzheimer's disease and related dementias

  • Treatment response to immunomodulatory therapies

  • Stratification of patients for clinical trials

Development of TYROBP-based biomarkers might include:

  • PET ligands targeting TYROBP or TYROBP-expressing cells

  • Measurement of soluble TYROBP in cerebrospinal fluid

  • Transcriptomic signatures in blood-derived monocytes that reflect CNS TYROBP activity

  • Integration with other microglial activation markers like TREM2 and APOE

These approaches could help monitor disease progression and treatment response in neurodegenerative conditions.

How do genetic variants in TYROBP influence disease risk and progression?

Genetic variants in TYROBP have been identified in early-onset Alzheimer's disease , and loss-of-function mutations in TYROBP result in Nasu-Hakola disease, a rare form of dementia . This suggests that both gain and loss of TYROBP function can contribute to neurodegeneration, depending on the context.

For comprehensive genetic assessment:

  • Screen for rare variants in TYROBP in diverse populations

  • Assess the functional consequences of identified variants on:

    • Protein expression and stability

    • Interaction with binding partners like TREM2

    • Downstream signaling efficiency

    • Microglial activation profiles

  • Develop cellular and animal models expressing TYROBP variants

  • Integrate genetic findings with transcriptomic and proteomic data

This multi-layered approach can help clarify how TYROBP genetics influence disease risk and progression, potentially leading to personalized therapeutic strategies.

What are the most promising approaches for targeting TYROBP in disease?

Based on current understanding, several approaches for targeting TYROBP show promise:

  • Modulation rather than complete inhibition or activation:

    • Stage-specific modulation (e.g., enhancement during amyloid-dominant phases, inhibition during tau-dominant phases)

    • Context-specific targeting (recruited vs. resident microglia)

  • Targeting specific downstream pathways:

    • Focus on TYROBP-APOE signaling axis

    • Selectively enhance phagocytic functions while minimizing inflammatory activation

  • Combination approaches:

    • Pair TYROBP modulation with TREM2 targeting

    • Combine with anti-inflammatory approaches to counteract potential adverse effects

  • Cell-specific delivery strategies:

    • Microglial-targeted delivery systems

    • Blood-brain barrier penetrant small molecules that modulate TYROBP signaling

These approaches should be evaluated systematically in preclinical models before advancing to clinical testing.

How might single-cell technologies advance our understanding of TYROBP function?

Single-cell technologies offer powerful approaches to further elucidate TYROBP function in health and disease:

  • Single-cell spatial transcriptomics:

    • Map TYROBP expression in relation to pathological features with greater precision

    • Identify microglial subpopulations with different TYROBP-related signatures

    • Track changes in TYROBP-related pathways over disease progression

  • Multi-omics approaches:

    • Integrate transcriptomic, proteomic, and epigenomic data at single-cell resolution

    • Identify regulatory networks controlling TYROBP expression

    • Link genetic variants to cell-type-specific functional changes

  • Live imaging of TYROBP-dependent processes:

    • Visualize TYROBP-dependent microglial recruitment and activation in real-time

    • Track TYROBP-mediated phagocytosis of pathological proteins

    • Monitor TYROBP-dependent signaling using fluorescent reporters

These advanced technologies will provide unprecedented insights into the complex roles of TYROBP in microglial function and neurodegeneration.

What is the translational potential of TYROBP research beyond neurodegeneration?

TYROBP research has significant translational potential beyond neurodegeneration, particularly in:

  • Cancer immunology:

    • TYROBP-positive endothelial cells show strong associations with immune activation in tumors

    • High TYROBP-positive EC enrichment correlates with "hot" tumor states and higher expression of immune checkpoint inhibitors

    • This suggests potential applications in cancer immunotherapy and biomarker development

  • Inflammatory disorders:

    • TYROBP functions in innate immune signaling across multiple cell types

    • Targeting TYROBP might modulate inflammatory responses in conditions like rheumatoid arthritis or inflammatory bowel disease

  • Tissue repair and regeneration:

    • TYROBP's role in microglial recruitment suggests potential applications in promoting tissue repair

    • Modulating TYROBP signaling might enhance beneficial immune responses after injury

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.