Recombinant Human Ubiquitin-associated domain-containing protein 2 (UBAC2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
UBAC2; PHGDHL1; PSEC0110; Ubiquitin-associated domain-containing protein 2; UBA domain-containing protein 2; Phosphoglycerate dehydrogenase-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-344
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
UBAC2
Target Protein Sequence
HCQKLFVYDLHAVKNDFQIWRLICGRIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASF LLGSWVLSALFDFLLIEAMQYFFGITAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILG PLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFS WTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINW NRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLN VATNFLLQH
Uniprot No.

Target Background

Function
UBAC2 restricts the trafficking of FAF2 from the endoplasmic reticulum to lipid droplets. In conjunction with LMBR1L and the E3 ubiquitin-protein ligase AMFR, it negatively regulates the canonical Wnt signaling pathway in lymphocytes by promoting the ubiquitin-mediated degradation of CTNNB1 and Wnt receptors FZD6 and LRP6.
Gene References Into Functions
  1. UBAC2 association with Behcet's disease in Chinese patients suggests its role in transcriptional modulation. PMID: 22455605
  2. Genetic association between UBAC2 and Behcet's disease was established and confirmed across three independent patient and control cohorts. PMID: 21918955
  3. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 20486

KEGG: hsa:337867

STRING: 9606.ENSP00000383911

UniGene: Hs.508545

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is UBAC2 and what are its primary structural features?

UBAC2 (Ubiquitin-associated domain-containing protein 2) is a protein that contains a ubiquitin-associated (UBA) domain, which enables it to bind to ubiquitin moieties. The human UBAC2 gene is located at chromosome 13q32, and the protein contains conserved domains that facilitate its integration with the ubiquitin-proteasome system. UBAC2 has recently been identified as an important ER-phagy receptor that plays crucial roles in maintaining ER homeostasis and suppressing inflammatory responses .

Structure analysis reveals UBAC2 contains:

  • An N-terminal transmembrane domain

  • A central region with structural flexibility

  • A C-terminal ubiquitin-associated (UBA) domain that facilitates interaction with ubiquitinated proteins

  • A LIR (LC3-interacting region) motif that enables interaction with autophagy machinery, specifically GABARAP

How does UBAC2 function in cellular processes?

UBAC2 functions primarily as an ER-phagy receptor that facilitates the selective degradation of endoplasmic reticulum components through autophagy. Experimental data demonstrates that UBAC2:

  • Promotes ER-phagy flux by interacting with GABARAP through its LIR motif

  • Reduces ER content under normal conditions and during ER stress

  • Suppresses unfolded protein response (UPR) activation

  • Restrains inflammatory responses by modulating ER homeostasis

When UBAC2 is depleted using CRISPR-Cas9 methods, cells exhibit:

  • Reduced ER-phagy flux under starvation and ER stress conditions

  • Decreased number of autophagic puncta

  • Increased ER content and expansion, particularly in the cell periphery

  • Enhanced inflammatory responses

What is the tissue distribution and expression pattern of UBAC2?

UBAC2 exhibits a broad expression pattern across multiple cell types and tissues. According to several studies:

  • It is upregulated in various cancerous tissues compared to adjacent normal tissues, as observed in bladder cancer

  • Expression levels vary across different cell lines, with particularly high expression noted in certain cancer cell lines such as EJ and UMUC3 bladder cancer cells

  • Expression can be modulated by genetic polymorphisms, with certain SNPs (such as rs9517723) associated with increased UBAC2 expression

What are the recommended approaches for UBAC2 knockout in cell lines?

CRISPR-Cas9 genome editing has emerged as the preferred method for generating UBAC2 knockout cell lines due to its efficiency and specificity. Based on current research protocols:

Recommended CRISPR-Cas9 workflow for UBAC2 knockout:

  • gRNA design: Target early constitutive exons of UBAC2 with 3-4 sgRNAs per gene to ensure successful knockout. Use specialized algorithms to minimize off-target effects .

  • Delivery method selection: Choose between:

    • Lentiviral transduction (preferred for difficult-to-transfect cells)

    • Electroporation (for higher efficiency in amenable cell types)

  • Clone selection and validation: After puromycin selection, isolate single-cell clones and validate knockout using:

    • PCR-based Surveyor assay to detect indels

    • Sanger sequencing of the targeted region

    • Western blot analysis to confirm absence of UBAC2 protein19

Several studies have successfully generated UBAC2 knockout cell lines in HeLa, THP-1, and HT-29 cells using this approach, allowing the investigation of UBAC2's role in ER-phagy and inflammatory responses .

What experimental approaches best elucidate UBAC2's role in the ER-phagy pathway?

To investigate UBAC2's function in ER-phagy, researchers have successfully employed these methodologies:

  • ER-phagy flux monitoring systems:

    • Utilize fluorescent reporter systems (such as ER-targeted RFP-GFP tandem reporters)

    • Measure the production of RFP fragments under autophagy-inducing conditions

    • Compare wild-type cells with UBAC2 knockout cells to quantify differences in ER-phagy flux

  • Visualization of ER content and morphology:

    • Fluorescence microscopy with ER-specific markers

    • Electron microscopy to observe ER expansion and ultrastructural changes

    • Quantification of ER protein levels by western blotting

  • Protein-protein interaction studies:

    • Co-immunoprecipitation (Co-IP) to assess interactions with other ER-phagy receptors (e.g., FAM134B)

    • Pulldown assays to identify UBAC2-binding partners

    • Mutational analysis focusing on functional domains (e.g., LIR motif mutants)

How is UBAC2 associated with Behçet's disease?

UBAC2 has been implicated in Behçet's disease through multiple genetic studies across different populations:

Key genetic associations:

PopulationAssociated SNPP-value (corrected)Odds Ratio (95% CI)Effect
Turkishrs95135840.0291.6 (1.2-2.3)Risk allele associated with disease
Chinesers95135840.0181.4 (1.1-1.8)Risk allele associated with disease
Japanesers95177230.0099 (ocular)1.56TT genotype associated with ocular lesions
Japanesers95177230.0052 (CNS)3.42TT genotype associated with CNS lesions

Mechanistic insights suggest that enhanced UBAC2 expression (associated with homozygous risk alleles like rs9517723 TT) could induce overactivation of ubiquitination-related pathways, contributing to the development of ocular and central nervous system lesions in Behçet's disease patients .

Fine-mapping studies have identified multiple risk SNPs within the UBAC2 gene region, with three SNPs (rs3825427, rs9517668, and rs9517701) being consistently associated with Behçet's disease across different cohorts .

What is the role of UBAC2 in cancer development, particularly in bladder cancer?

UBAC2 has been identified as having oncogenic properties in bladder cancer and potentially other malignancies:

  • Expression pattern in cancer:

    • Both UBAC2 mRNA and protein levels are significantly upregulated in bladder cancer tissues compared to adjacent normal tissues

    • Higher expression observed in multiple bladder cancer cell lines (RT4, EJ, UMUC3, T24, T24T) compared to normal uroepithelium cells

  • Functional impact in cancer cells:

    • Knockdown of UBAC2 inhibits bladder cancer cell proliferation both in vitro and in vivo

    • UBAC2 depletion results in cell cycle arrest at G0/G1 phase

    • Xenograft tumors derived from UBAC2-knockdown cells show decreased growth rate and reduced expression of proliferation marker Ki-67

  • Molecular mechanism in bladder cancer:

    • UBAC2 knockdown increases expression of p27, a cell cycle inhibitor

    • UBAC2 may regulate p27 through post-transcriptional mechanisms

    • UBAC2 appears to influence the circular RNA BCRC-3/miR-182-5p/p27 regulatory axis

  • Clinical significance:

    • Kaplan-Meier survival analysis of 406 bladder cancer cases from TCGA database revealed that higher UBAC2 expression correlates with lower survival rates

How does UBAC2 function as an ER-phagy receptor and differ from other known receptors?

UBAC2 has recently been identified as a novel ER-phagy receptor with distinct characteristics from previously known receptors:

  • Mechanistic distinctiveness:

    • UBAC2 interacts with GABARAP through its LIR motif to promote ER-phagy

    • Unlike other receptors, UBAC2's function is independent of known ER-phagy receptors such as FAM134B, ATL3, SEC62, RTN3, CCPG1, and TEX264

    • Depletion of FAM134B does not affect UBAC2-promoted ER-phagy

  • Functional consequences of UBAC2 manipulation:

    • WT UBAC2, but not LIR motif mutants (UBAC2 LIRm), promotes ER-phagy flux and reduces ER content

    • UBAC2 knockout leads to striking ER expansion, particularly in the cell periphery

    • This phenotype can be rescued by wild-type UBAC2 but not by the LIR motif mutant

  • Evolutionary conservation:

    • UBAC2 appears to be a eukaryotic conserved ER regulator

    • In Arabidopsis, UBAC2 proteins associate with ATG8-interacting ATI3 proteins and function in plant stress responses

    • This suggests a broadly conserved role in ER homeostasis across different kingdoms

What is the relationship between UBAC2 and inflammatory responses?

Recent research has revealed UBAC2 as a critical regulator of inflammatory responses through its function in ER-phagy:

  • Suppression of inflammation:

    • UBAC2 functions as a guardian for ER-phagy and ER turnover

    • By maintaining ER homeostasis, UBAC2 suppresses inflammatory responses

    • UBAC2 depletion increases inflammatory responses by impairing ER-phagy

  • Unfolded protein response (UPR) regulation:

    • The UPR is aggravated in UBAC2-deficient cells

    • Similar effects are observed in cells expressing UBAC2 with LIR motif mutations

    • This suggests UBAC2 restrains UPR activation through its ER-phagy activity

  • In vivo validation:

    • Mice expressing disease-associated human UBAC2 mutants show:

      • Decreased ER-phagy

      • Increased inflammatory responses

      • Enhanced susceptibility to DSS-induced colitis

This emerging understanding positions UBAC2 as a promising therapeutic target for inflammatory conditions, especially given its association with Behçet's disease and other inflammatory disorders.

How do post-translational modifications and protein interactions regulate UBAC2 function?

Post-translational modifications and protein interactions play crucial roles in regulating UBAC2 activity:

  • Phosphorylation:

    • UBAC2 has been identified as a phospho-regulated ER-phagy receptor

    • Phosphorylation status affects its interaction with autophagy machinery

    • This provides a mechanism for dynamic regulation of ER-phagy in response to cellular conditions

  • Ubiquitination:

    • As a UBA domain-containing protein, UBAC2 can interact with ubiquitinated proteins

    • This property may enable UBAC2 to recognize and target specific ER components for degradation

    • Similar to how other UBA-containing proteins like Rad23 bind ubiquitin and regulate protein degradation

  • Protein interactions:

    • UBAC2 interacts with GABARAP through its LIR motif, which is essential for its ER-phagy function

    • It shows weak interaction with FAM134B, but this interaction is not affected by starvation-induced autophagy activation

    • UBAC2-promoted ER-phagy is not dependent on other known ER-phagy receptors, suggesting distinct mechanistic pathways

What are the common pitfalls in generating and validating UBAC2 knockout models?

Researchers often encounter several challenges when creating and validating UBAC2 knockout models:

  • Off-target effects in CRISPR-based knockout:

    • Solution: Design multiple sgRNAs targeting different regions of UBAC2

    • Validate with comprehensive off-target analysis using methods like GUIDE-seq or CIRCLE-seq

    • Compare phenotypes from multiple independent knockout clones to ensure consistency

  • Incomplete knockout validation:

    • Solution: Employ multiple validation approaches:

      • Genomic DNA sequencing to confirm mutations

      • Western blotting to verify complete absence of protein

      • Functional assays to confirm loss of UBAC2-dependent activities (e.g., ER-phagy)19

  • Compensation by redundant mechanisms:

    • Solution: Consider acute knockout systems (e.g., inducible CRISPR) to minimize adaptive responses

    • Analyze expression of related proteins with similar functions

    • Compare acute vs. chronic knockout phenotypes to identify compensatory effects

How can researchers optimize experimental conditions for studying UBAC2-mediated ER-phagy?

To effectively study UBAC2's role in ER-phagy, researchers should optimize these experimental parameters:

  • ER-phagy induction protocols:

    • Use both starvation (EBSS medium) and ER stress inducers (e.g., thapsigargin)

    • Optimize treatment duration: typically 4-6 hours for starvation, 12-24 hours for ER stress inducers

    • Include appropriate positive controls for each induction method

  • ER-phagy flux measurement:

    • Implement tandem fluorescent reporters (RFP-GFP-KDEL) for real-time monitoring

    • Include lysosomal inhibitors (e.g., bafilomycin A1) to distinguish between increased flux and blocked degradation

    • Normalize fluorescence quantification to cell number or area

  • UBAC2 reconstitution experiments:

    • Express wild-type UBAC2 and functional mutants (e.g., LIR mutant) at physiological levels

    • Use inducible expression systems to control timing and expression levels

    • Include domain deletion variants to map functional regions beyond the LIR motif

What methodological approaches best resolve contradictions in UBAC2 functional studies?

When faced with contradictory results in UBAC2 research, consider these methodological strategies:

  • Cell type-specific effects:

    • Validate findings across multiple cell lines representing different tissues

    • Compare primary cells with immortalized lines

    • Consider tissue-specific cofactors that might influence UBAC2 function

  • Experimental condition variations:

    • Standardize key parameters (confluence, passage number, culture conditions)

    • Perform time-course experiments to capture dynamic responses

    • Test both basal and stressed conditions to identify context-dependent functions

  • Technical approach diversification:

    • Combine genetic approaches (CRISPR knockout, siRNA knockdown) with pharmacological interventions

    • Utilize complementary techniques to measure the same endpoint

    • Implement rescue experiments with structure-guided mutants to pinpoint critical functional residues

What are the unexplored therapeutic potentials of targeting UBAC2 in disease?

Several promising therapeutic avenues warrant investigation:

  • Inflammatory disorders:

    • Enhancing UBAC2 function could potentially mitigate inflammatory responses in conditions like Behçet's disease

    • Small molecules that stabilize UBAC2 or enhance its ER-phagy activity might have anti-inflammatory effects

    • Disease-associated UBAC2 variants could be targeted for correction using gene therapy approaches

  • Cancer therapeutics:

    • UBAC2 inhibition might sensitize bladder cancer and other UBAC2-overexpressing tumors to treatment

    • Combination therapies targeting both UBAC2 and its downstream effectors could provide synergistic effects

    • Biomarker development based on UBAC2 expression/mutation status could aid in patient stratification

  • ER stress-related diseases:

    • Modulation of UBAC2-mediated ER-phagy could potentially benefit conditions associated with ER stress

    • This includes neurodegenerative disorders, diabetes, and other diseases with prominent UPR activation

    • Screening for compounds that selectively enhance UBAC2's ER-phagy function without affecting other cellular processes

How might single-cell approaches advance our understanding of UBAC2 biology?

Single-cell technologies offer unique opportunities to dissect UBAC2 function:

  • Single-cell transcriptomics:

    • Profiling transcriptional responses to UBAC2 modulation at single-cell resolution

    • Identifying cell type-specific dependencies on UBAC2 function

    • Characterizing heterogeneous responses to ER stress in UBAC2-deficient populations

  • Spatial transcriptomics/proteomics:

    • Mapping UBAC2 expression and activity in tissue contexts

    • Correlating UBAC2 function with local inflammatory signatures

    • Visualizing subcellular distribution of UBAC2 and its binding partners

  • Single-cell CRISPR screens:

    • Identifying genetic interactions with UBAC2 through combinatorial CRISPR screens

    • Mapping pathway dependencies in UBAC2-deficient cells

    • Discovering synthetic lethal interactions that could be therapeutically exploited

By implementing these emerging technologies, researchers can uncover new dimensions of UBAC2 biology that have remained inaccessible through bulk analysis methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.