Recombinant Human UDP-glucuronosyltransferase 2B17 (UGT2B17)

Shipped with Ice Packs
In Stock

Description

Introduction to UGT2B17

UGT2B17 belongs to the uridine diphosphoglucuronosyltransferase family, a group of enzymes responsible for conjugating glucuronic acid to various endogenous and exogenous compounds. This enzyme is expressed in several tissues, with notable expression in the liver and intestine, where it plays a crucial role in detoxification pathways . UGT2B17 is particularly significant due to its involvement in the metabolism of androgens such as testosterone and dihydrotestosterone, as well as various therapeutic drugs .

The UGT2B17 gene is located on chromosome 4q13, as confirmed by fluorescence in situ hybridization studies of normal human lymphocyte chromosomes . Interestingly, the gene exhibits a high degree of polymorphism across populations, including a common deletion variant that significantly affects enzyme activity and substrate metabolism .

Protein Structure

The crystal structure of the UDP-glucuronic acid binding domain of UGT2B17 has been determined at 1.8 Å resolution, revealing important insights into its function . The C-terminal domain (2B7CT, residues 285-451) adopts a globular structure with a Rossman-type fold, consisting of a single parallel β-sheet with six individual strands surrounded by seven α-helices . This structure is consistent with the GT-B fold family of glycosyltransferases, to which UGT2B17 belongs.

The presumptive UDP-glucuronic acid (UDPGA) binding site of UGT2B17 is remarkably similar to the UDP-glucose binding site found in other glycosyltransferases, with only a handful of amino acid differences . This binding site shows high conservation across human UGTs, suggesting a common mechanism for interaction with UDPGA.

Enzymatic Function

UGT2B17 catalyzes the transfer of glucuronic acid from UDP-glucuronic acid to various lipophilic substrates, forming glucuronide conjugates. This reaction typically occurs at hydroxyl, carboxyl, amino, or sulfhydryl groups of the substrate . The enzyme demonstrates high substrate specificity, particularly for androgens and certain drugs, with kinetic parameters that differ significantly from other UGT enzymes .

In vitro enzyme kinetic studies have shown that UGT2B17 often exhibits lower Km values for its substrates compared to other UGT enzymes, indicating higher affinity. For example, with the drug MK-7246, recombinant UGT2B17 showed a Km value of 3.2 µmol/l, which was approximately 25-30 fold lower than other recombinant UGTs .

Recombinant UGT2B17 Production Methods

Recombinant UGT2B17 can be produced using various expression systems, each with distinct advantages and characteristics. These production methods are essential for obtaining sufficient quantities of the enzyme for research and application purposes.

Yeast Expression

Yeast-based expression systems provide an alternative for producing recombinant UGT2B17 with more complex post-translational modifications than bacterial systems . These systems can yield functional enzyme with properties more closely resembling the native human protein.

Baculovirus Expression

Baculovirus expression systems utilize insect cells infected with recombinant baculoviruses carrying the UGT2B17 gene . This method can produce higher quantities of properly folded and functionally active recombinant enzyme.

Mammalian Cell Expression

Mammalian cell expression systems represent the most sophisticated approach for producing recombinant UGT2B17, potentially providing the most accurate post-translational modifications and protein folding . These systems are particularly valuable when studying enzyme function in a context more closely resembling human physiology.

Protein Modifications

Recombinant UGT2B17 can be produced with various modifications to enhance its utility for specific applications. For instance, Avi-tag biotinylated UGT2B17 is produced using E. coli biotin ligase (BirA) to covalently attach biotin to an AviTag peptide on the recombinant protein . Such modifications facilitate protein purification, immobilization, and detection in experimental settings.

Role of UGT2B17 in Drug Metabolism

UGT2B17 plays a significant role in the metabolism of various therapeutic drugs, with its genetic polymorphisms causing substantial variability in drug pharmacokinetics and efficacy.

Impact on Drug Pharmacokinetics

The influence of UGT2B17 on drug metabolism is perhaps most dramatically illustrated by its effect on MK-7246, a drug developed for respiratory diseases. In a first-in-human study, individuals with the UGT2B17*2/*2 genotype (lacking functional UGT2B17 protein) showed remarkably different pharmacokinetic profiles compared to those with at least one functional UGT2B17 allele .

Table 1: Impact of UGT2B17 Genotype on MK-7246 Pharmacokinetics

ParameterUGT2B17*1/*1 (Wild-type)UGT2B17*2/*2 (Deletion)Fold Difference
Area under curve (AUC)Lower25-fold greater25×
Peak concentrationLower82-fold greater82×
M3-to-MK-7246 AUC ratioHigher24-fold lower24×
Half-lifeSimilarSimilarMinimal

These dramatic differences in drug pharmacokinetics highlight the critical role of UGT2B17 in first-pass metabolism, particularly in the intestine where UGT2B17 mRNA expression is approximately 13-fold higher than in the liver .

Substrate Specificity

UGT2B17 exhibits substrate specificity for various drugs. Some notable examples include:

  1. MK-7246: UGT2B17 is the primary enzyme responsible for its glucuronidation

  2. Exemestane: Used in breast cancer treatment, with UGT2B17 being crucial for forming 17β-DHE-Gluc

  3. Vorinostat: An HDAC inhibitor metabolized by UGT2B17

  4. Lorcaserin: A weight management drug that undergoes UGT2B17-mediated glucuronidation

  5. Imatinib: Interestingly, imatinib serves as a selective inhibitor of UGT2B17

Androgen Metabolism

UGT2B17 is critical for the metabolism of androgens, particularly testosterone and dihydrotestosterone (DHT). The enzyme catalyzes the formation of testosterone glucuronide (TG) and dihydrotestosterone glucuronide, which are more readily excreted from the body .

In a study using human liver microsomes, UGT2B17 protein abundance showed significant correlation (r² = 0.77, p < 0.001) with testosterone glucuronide formation . The primary role of UGT2B17 in testosterone glucuronidation compared to UGT2B15 was confirmed through activity assays in UGT2B17 gene deletion samples and with selective UGT2B17 inhibitors .

Clinical Implications

The role of UGT2B17 in androgen metabolism has significant clinical implications, particularly for conditions influenced by androgen levels. For example, UGT2B17 expression in primary prostate tumors has been associated with node-positive disease and linked to circulating levels of 3α-diol-17 glucuronide, a major circulating DHT metabolite .

Furthermore, UGT2B17 has been identified as an independent prognostic factor linked to biochemical recurrence after radical prostatectomy, with its overexpression associated with the development of metastasis in prostate cancer patients .

Common Genetic Variants

The UGT2B17 gene exhibits significant genetic polymorphism, with the most notable being a complete gene deletion (UGT2B17*2/*2 genotype). This deletion results in the absence of functional UGT2B17 enzyme and dramatically affects the metabolism of UGT2B17 substrates .

The frequency of this deletion variant varies significantly across populations, showing evidence of adaptive evolution. Analysis of copy number variation (CNV) data has identified UGT2B17 as an extreme outlier, ranking as the fifth most extreme outlier out of 2404 copy-number-variable clones (p < 0.002) .

Effects on Liver Proteome

Recent research has shown that UGT2B17 deficiency affects the composition and function of the liver proteome, potentially provoking compensatory responses . In UGT2B17-deficient livers, 80% of altered proteins showed increased abundance, with notable enrichment in various metabolic and chemical defense pathways, cellular stress, and immune-related responses .

Enzymes involved in the homeostasis of steroids, nicotinamide, carbohydrate and energy metabolism, and sugar pathways were also more abundant in UGT2B17-deficient individuals. Interestingly, these compensatory mechanisms do not appear to involve other UGT enzymes, suggesting alternative metabolic adaptations .

Age and Sex Variations

UGT2B17 protein abundance varies significantly with age and sex, which may contribute to differences in drug metabolism and androgen processing across demographic groups .

Table 2: UGT2B17 Protein Abundance by Age and Sex

Demographic GroupMean UGT2B17 (pmol/mg microsomal protein)Notes
Children < 9 years0.12 ± 0.24Sparsely expressed
Adults~10-fold increase from age 9Significant increase with age
Adult males1.22.6-fold greater than females
Adult females0.47Lower expression than males

These age and sex-related differences in UGT2B17 expression may have important implications for drug dosing and metabolism across different demographic groups.

Drug Discovery and Development

Recombinant UGT2B17 serves as a valuable tool in drug discovery and development processes, enabling researchers to predict potential drug-drug interactions, assess metabolic stability, and identify potential variations in drug response due to UGT2B17 polymorphisms .

Drug companies are advised to include UGT2B17 in early phenotyping assays during drug discovery to avoid late clinical failures, particularly for compounds that might be substantially metabolized by this enzyme .

Personalized Medicine

The significant impact of UGT2B17 genetic polymorphisms on drug metabolism makes it an important consideration for personalized medicine approaches . Genotyping patients for UGT2B17 variants could potentially guide dosing decisions for drugs known to be UGT2B17 substrates, improving efficacy and reducing adverse effects.

For example, in the case of exemestane used for breast cancer treatment, patients with the UGT2B17*2/2 genotype showed 39-fold lower levels of urinary 17β-DHE-Gluc and 29-fold lower plasma levels of 17β-DHE-Gluc compared to patients with the UGT2B171/*1 genotype . These significant differences could potentially impact treatment efficacy and side effect profiles.

Research Applications

Recombinant UGT2B17 is essential for studying:

  • Enzyme kinetics and substrate specificity

  • Structure-function relationships

  • Drug metabolism pathways

  • Development of selective inhibitors

  • Mechanisms of genetic regulation

Future Research Directions

Several promising avenues for future research on recombinant UGT2B17 include:

  1. Alternative Promoter Control: Recent research has identified that distinctive alternative promoters dictate UGT2B17-dependent androgen catabolism in localized and metastatic prostate cancer, suggesting a new level of regulation that warrants further investigation .

  2. Compensatory Mechanisms: The liver proteome alterations in UGT2B17-deficient individuals suggest disrupted hepatocellular homeostasis and potential compensatory mechanisms that remain to be fully characterized .

  3. Therapeutic Applications: Development of UGT2B17 inhibitors or inducers could potentially modulate drug metabolism or androgen processing for therapeutic benefit in various conditions.

  4. Refined Recombinant Systems: Creating more sophisticated recombinant UGT2B17 production systems that better recapitulate the natural environment and post-translational modifications of the enzyme.

  5. PBPK Modeling: Utilizing the observational and mechanistic data on UGT2B17 to develop physiologically-based pharmacokinetic (PBPK) models for predicting highly-variable first-pass metabolism of testosterone and other UGT2B17 substrates .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based buffer with 6% Trehalose.
Form
Liquid or Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement in the order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery time information, please contact your local distributors.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
(UDPGT 2B17)(UGT2B17)(C19-steroid-specific UDP-glucuronosyltransferase)(C19-steroid-specific UDPGT)
Datasheet & Coa
Please contact us to get it.
Expression Region
24-530aa
Mol. Weight
64.5 kDa
Protein Length
Full Length of Mature Protein
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Metabolism
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
UGT2B17
Target Protein Sequence
GKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
UDP-glucuronosyltransferase (UGT) is an enzyme that catalyzes phase II biotransformation reactions. In these reactions, lipophilic substrates are conjugated with glucuronic acid, increasing the metabolite's water solubility and facilitating excretion into either the urine or bile. This enzyme catalyzes the glucuronidation of endogenous steroid hormones such as androgens (epitestosterone, androsterone) and estrogens (estradiol, epiestradiol).
Gene References Into Functions
  1. These data can be used to predict variability in the metabolism of UGT2B17 substrates. PMID: 29602798
  2. UGT2B17 was deleted in 64% of children with lymphoblastic malignancy, but in 83% of children with non-lymphoblastic malignancy. UGT2B17 deletion polymorphism may improve the relapse-free rate in children with non-lymphoblastic malignancy. PMID: 27805301
  3. Study provides the first evidence of null genotype involvement in UGT2B17 as a risk factor for benign prostatic hyperplasia. PMID: 28882566
  4. Chronic lymphocytic leukemia patients with high UGT2B17 and LPL expression have significantly reduced survival. PMID: 26589911
  5. UGT2B17 contributes to the in-vitro glucuronidation of arctigenin in liver/intestinal microsomes. PMID: 26407805
  6. GC-C-IRMS analysis sensitive to testosterone doping independent of UGT2B17 genotype. PMID: 26198073
  7. UGT2B17 mismatch has a negative clinical impact in allogeneic HSCT from HLA-identical sibling donors only when a male donor is used. PMID: 26367234
  8. This descriptive study examines correlations between concentrations of tamoxifen's glucuronide metabolites and genotypes UGT1A4, UGT2B7, UGT2B15 and UGT2B17 in 132 patients with estrogen receptor-positive breast cancer under treatment with tamoxifen. PMID: 26176234
  9. UGT2B17 deletion polymorphisms are associated with the risk of developing pancreatic cancer in Chinese Han population, especially in the female population. PMID: 26882814
  10. UGT2B17-deletion interacting with p16 (+) may modify effects of smoking on TP53-mutations and may further interact with the disruptive TP53-mutations to raise relapse rates among Japanese patients with head and neck squamous cell carcinomas. PMID: 25886176
  11. These data suggest that UGT2B17 deletion leads to reduced UGT2B17 activity, and lower BMI in male individuals. This is consistent with the hypothesis that reduced UGT2B17-mediated testosterone excretion results in higher testosterone levels PMID: 25794161
  12. The UGT2B17 deletion polymorphism is not associated with tumor risks. PMID: 24802609
  13. Structural variants unique to the malignant cell line inactivated: UGT2B17, a gene that inactivates dihydrotestosterone, a known activator of prostate cancer progression. PMID: 23792589
  14. Variation in 3HC glucuronidation activity by CYP2A6 caused by UGT2B17 gene deletions did not significantly alter nicotine metabolite ratio in smokers. PMID: 23936477
  15. UGT2B17 is a possible target for androgen deprivation therapy of prostate cancer. PMID: 24121496
  16. Study indicates that UGT2B17 is not a crucial factor in lung carcinogenesis among Caucasians and shows the importance of investigating such markers in large cohorts from different populations. PMID: 23850147
  17. association of the UGT2B17 CNV with AS is particularly interesting given the recent association of this CNV with osteoporosis and the proposed function as it encodes a key enzyme that inhibits androgens PMID: 23927372
  18. The prevalence of the UGT2B17 deletion genotype is extremely high in Japanese subjects. PMID: 22887913
  19. We observed a significant association between UGT2B17 expressing recipients and UGT2B17 deficient donors with the severity of Acute graft versus host disease. PMID: 22726315
  20. The androgen receptor assay may serve as a complement to the urinary testosterone/epitestosterone (T/E) doping test, because this is profoundly influenced by the UGT2B17 deletion polymorphism. PMID: 23294483
  21. Report UGT2B17 expression in fetal/adult tissues. PMID: 23223495
  22. The present study was aimed to investigate the possible association between 19-base pair (bp) deletion polymorphism of the DHFR gene (rs70991108), null genotype of UGT2B17 as well as the expression level of NGX6 with the risk of breast cancer. PMID: 23053953
  23. Data from an in vitro supersome/microsome-based assay suggest that the key steroid-metabolizing enzyme UGT2B17 is inhibited by phenolic dietary substances in red wine and therefore may reduce the rate of testosterone glucuronidation in vivo. PMID: 22958586
  24. observed an exclusive involvement of the 2B17 isoform within the UGT protein family in poor-risk chronic lymphocytic leukemia PMID: 23169782
  25. Genetic variations in the UGT2B17 gene dramatically affect the pharmacokinetics of MK-7246 in healthy subjects. PMID: 22669291
  26. The UGT2B17 Del polymorphism may significantly contribute to prostate cancer susceptibility in men. (Meta-analysis) PMID: 21919858
  27. UGT2B17 gene deletion associated with an increase in bone mineral density similar to the effect of hormone replacement in postmenopausal women PMID: 21614655
  28. we found no evidence of an effect of UGT2B17 CNV on osteoporosis risk in elderly Caucasian women. PMID: 20878390
  29. Data show that 698 CNPs loci overlap with known disease-associated or pharmacogenetic-related genes such as CFHR3, CFHR1, GSTTI and UGT2B17. PMID: 21677662
  30. data suggest that men have a higher amount of UGT2B17 glucuronidation activity then women PMID: 20810538
  31. UGT2B17 expression in prostate cancer is regulated by a novel polymorphism in forkhead boxA1 binding site. PMID: 20628005
  32. Overexpression of UGT2B17 is associated with endometrial cancer. PMID: 20554747
  33. the association of deletion polymorphism in the UGT2B17 gene with the occurrence of renal disorders on chronic exposure to anabolic androgenic steroids PMID: 20429943
  34. Observational study of genetic testing. (HuGE Navigator) PMID: 20192879
  35. UGT2B17 deletion polymorphism is associated with a reduced rate of NNAL detoxification in vivo and may increase individual susceptibility to tobacco-related cancers. PMID: 16220109
  36. The UGT2B17 polymorphism is strongly associated with the bimodal distribution of testosterone excretion and also with the large difference in testosterone excretion between Koreans and Swedes. PMID: 16332934
  37. Deletion polymorphism of UDP-glucuronosyltransferase 2B17 is associated with prostate cancer PMID: 16896035
  38. The UGT2B17 deletion polymorphism is associated with prostate cancer risk. PMID: 17387331
  39. association of the UGT2B17 deletion with increased lung adenocarcinoma in women is consistent with its association with decreased 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanol glucuronidation rates in women PMID: 17416778
  40. results suggest that the HSD3B1 N367T and UGT2B17 null polymorphisms may modify the risk of prostate cancer, particularly among men with a family history of the disease PMID: 17826523
  41. These findings show that the UGT2B17 deletion polymorphism is not associated with prostate cancer risk in Caucasians. PMID: 17935910
  42. The UGT2B17 deletion polymorphism does not play a major role in prostate cancer susceptibility as previously indicated. PMID: 18247404
  43. UGT2B17 ia a primary androgen-regulated genes and androgen receptor is required for basal expression and androgen-regulated expression. PMID: 18302198
  44. Diversity was unusually high, with evidence of balancing selection in Europe. In contrast, diversity was low in East Asia where a single haplotype predominated, suggesting positive selection for the deletion in this part of the world PMID: 18760392
  45. Genome-wide copy-number variation identified a susceptibility gene, UGT2B17, for osteoporosis. PMID: 18992858
  46. In pubertal boys, a common homozygous deletion in the UGT2B17 gene strongly affected urinary excretion pattern of androgen metabolites but did not influence circulating androgen levels. PMID: 19088161
  47. Large testosterone excretion is associated with a deletion polymorphism of the UGT2B17 gene. This polymorphism decreases T/E ratio level. PMID: 19224506
  48. Copy-number variations (CNVs) of the human sex steroid metabolizing genes UGT2B17 PMID: 19572376

Show More

Hide All

Database Links

HGNC: 12547

OMIM: 601903

KEGG: hsa:7367

STRING: 9606.ENSP00000320401

UniGene: Hs.575083

Protein Families
UDP-glycosyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in various tissues including the liver, kidney, testis, uterus, placenta, mammary gland, adrenal gland, skin and prostate.

Q&A

What is UDP-glucuronosyltransferase 2B17 and what is its primary biological function?

UDP-glucuronosyltransferase 2B17 (UGT2B17) belongs to the UGT family of enzymes that catalyze the conjugation of glucuronic acid to various substrates. This glucuronidation process increases the hydrophilicity of compounds, alters their biological activity, and facilitates their excretion through urine and bile . UGT2B17 has been identified as the major enzyme responsible for testosterone glucuronidation, while UGT2B15 plays a comparatively minor role in this process .

The primary function of UGT2B17 is to facilitate the detoxification and elimination of both endogenous compounds (particularly androgens) and xenobiotics from the body. This enzyme catalyzes glucuronidation at multiple hydroxyl positions, making it particularly efficient in steroid metabolism compared to other UGT enzymes that may have more restricted site specificity .

Where is UGT2B17 expressed in human tissues?

UGT2B17 demonstrates a tissue-specific expression pattern that influences its metabolic impact. While UGT enzymes including UGT2B17 are predominantly expressed in the liver (the primary site of drug metabolism), they are also found in various extrahepatic tissues including the kidney, gastrointestinal tract, lungs, prostate, mammary glands, skin, brain, spleen, and nasal mucosa .

This widespread distribution explains why UGT2B17 impacts not only systemic drug metabolism but also local tissue-specific metabolism. The expression in organs like the prostate is particularly relevant to its role in androgen metabolism and potential implications for prostate cancer risk .

How does UGT2B17 differ from other UGT enzymes in substrate specificity?

UGT2B17 demonstrates distinct substrate specificity compared to other UGT enzymes, particularly in relation to steroid metabolism. Unlike UGT2B15 which acts only at the 17β-OH position of steroids, UGT2B17 catalyzes glucuronidation at multiple hydroxyl positions, making it more efficient in steroid elimination .

In enzyme kinetic studies, UGT2B17 has shown remarkably high affinity for certain substrates. For example, with the compound MK-7246, recombinant UGT2B17 exhibited a Km value of 3.2 μmol/l, which was 25-30 fold lower than other UGT enzymes (indicating much higher affinity) . This high substrate affinity was comparable to human intestinal microsomes and significantly better than other recombinant UGTs tested .

What are the known genetic polymorphisms of UGT2B17 and their functional consequences?

The most significant polymorphism identified in the UGT2B17 gene is a deletion polymorphism, which can result in complete absence of the UGT2B17 enzyme in individuals homozygous for the deletion (del/del genotype) . This polymorphism has profound functional consequences for steroid metabolism and drug pharmacokinetics.

The deletion polymorphism in UGT2B17 results in reduced glucuronidation capacity for various substrates, particularly androgens like testosterone. This reduction in metabolic capacity leads to altered pharmacokinetics of drugs that are substrates for UGT2B17. For example, individuals with the UGT2B17*2/2 genotype (homozygous deletion) show dramatically higher systemic exposure to certain drugs compared to those with the UGT2B171/*1 wild-type genotype .

How can researchers detect and characterize UGT2B17 polymorphisms in study populations?

For accurate genotyping of UGT2B17 polymorphisms, real-time PCR with allelic discrimination is the recommended method . This technique enables researchers to distinguish between the three possible genotypes: homozygous wild-type (ins/ins), heterozygous (ins/del), and homozygous deletion (del/del) .

A comprehensive approach to characterizing UGT2B17 polymorphisms in research populations should include:

  • DNA extraction from appropriate biological samples (blood, saliva, or tissue)

  • Real-time PCR with specific primers designed to detect the UGT2B17 deletion

  • Allelic discrimination analysis to determine genotype

  • Validation of results using positive and negative controls

  • Statistical analysis of genotype distributions in the studied population

When conducting population studies, researchers should account for potential ethnic differences in the frequency of UGT2B17 deletion, as considerable inter-ethnic variations have been reported .

How does UGT2B17 genetic variation affect drug pharmacokinetics?

UGT2B17 genetic polymorphisms can dramatically alter the pharmacokinetics of drugs that are substrates for this enzyme. The impact is particularly significant for individuals with the homozygous deletion genotype (UGT2B17*2/*2).

In clinical studies with the compound MK-7246, subjects with the UGT2B17*2/*2 genotype exhibited:

  • 25-fold greater mean dose-normalized area under the plasma concentration-time curve (AUC)

  • 82-fold greater peak concentration (Cmax)

  • 24-fold lower metabolite-to-parent drug AUC ratio

compared to subjects with the UGT2B17*1/*1 wild-type genotype .

UGT2B17 GenotypeRelative Dose-normalized AUCRelative Dose-normalized CmaxM3-to-MK-7246 AUC Ratio
*1/*1 (wild-type)1× (reference)1× (reference)24× higher than *2/*2
*1/*2 (heterozygous)2.5× higher than *1/*1Variable (high CV of 93%)Intermediate
*2/*2 (deletion)25× higher than *1/*182× higher than *1/*124× lower than *1/*1

These findings demonstrate that UGT2B17 deficiency can lead to dramatically increased drug exposure, potentially requiring dose adjustments or alternative treatments for affected individuals .

What alternative metabolic pathways exist for compounds typically metabolized by UGT2B17?

In individuals with deficient UGT2B17 function, several potential compensatory pathways might be engaged, though with varying efficiency:

  • Other UGT enzymes: UGT1A1, 1A3, 1A4, 1A8, 1A9, 1A10, 2B4, 2B7, and 2B15 may contribute to steroid glucuronidation, but with significantly lower efficiency than UGT2B17 .

  • Sulphation pathways: Research has shown that individuals with del/del UGT2B17 genotypes do not produce significantly increased amounts of steroid sulphate conjugates, suggesting that sulphation is not effectively upregulated as a compensatory mechanism .

  • Alternative elimination routes: In the absence of efficient glucuronidation, lipophilic unconjugated steroids may:

    • Distribute into body tissues

    • Incorporate into hair via endogenous routes

    • Excrete in sweat

    • Undergo minor direct urinary excretion as unconjugated compounds

The inadequacy of these alternative pathways explains the substantially altered pharmacokinetics observed in UGT2B17-deficient individuals and highlights the importance of considering genetic polymorphisms in drug development and dosing strategies.

What are the optimal methods for studying UGT2B17 enzyme kinetics?

For rigorous characterization of UGT2B17 enzyme kinetics, researchers should employ a multi-system approach comparing recombinant enzymes with human tissue microsomes. Based on published methodologies, the following approach is recommended:

  • Enzyme sources preparation:

    • Recombinant UGT2B17 expressed in suitable systems (e.g., baculovirus-infected insect cells)

    • Human liver microsomes (HLMs) from donors with known UGT2B17 genotypes

    • Human intestinal microsomes (HIMs) to assess extrahepatic metabolism

  • Kinetic analysis methodology:

    • Incubate substrate at varying concentrations with enzyme sources in the presence of UDP-glucuronic acid (UDPGA)

    • Measure reaction products using LC-MS/MS or other suitable analytical techniques

    • Plot substrate concentration versus reaction velocity to determine reaction kinetics

    • Calculate kinetic parameters (Km, Vmax) using appropriate software

  • Comparative analysis:

    • Compare kinetic parameters across different enzyme sources

    • Determine the relative contribution of UGT2B17 to total glucuronidation activity

This approach has successfully identified UGT2B17 as the major UGT enzyme for various substrates, showing its distinct kinetic properties compared to other UGT enzymes .

How can researchers effectively investigate the impact of UGT2B17 polymorphisms on drug metabolism?

To comprehensively investigate the impact of UGT2B17 polymorphisms on drug metabolism, a three-component research strategy is recommended:

  • Single-dose pharmacokinetic studies:

    • Administer labeled compounds to healthy volunteers with different UGT2B17 genotypes

    • Conduct comprehensive sample collection (blood, urine, hair, sweat)

    • Perform detailed pharmacokinetic analysis to determine differences in drug disposition

    • Quantify parent compounds and metabolites to assess metabolic pathways

  • Animal model studies:

    • Develop animal models with different UGT2B17 genotypes

    • Perform controlled comparative pharmacokinetic studies with acute and chronic drug administration

    • Monitor physiological parameters to assess potential toxicity

    • Compare animal data with human single-dose studies

  • Clinical genotype-phenotype correlation studies:

    • Analyze UGT2B17 genotypes in patients showing abnormal drug responses

    • Correlate genotypes with clinical outcomes and adverse events

    • Assess the prevalence of different UGT2B17 genotypes in patient populations

    • Evaluate the clinical significance of observed pharmacokinetic differences

This comprehensive approach allows researchers to establish causal relationships between UGT2B17 polymorphisms and clinically relevant pharmacokinetic variations.

What is the proposed connection between UGT2B17 gene deletion and renal disorders in anabolic steroid users?

A compelling hypothesis connects UGT2B17 gene deletion with increased risk of renal disorders in individuals using anabolic androgenic steroids (AAS) . The proposed mechanism involves several interconnected pathways:

  • Impaired steroid elimination: UGT2B17 deficiency leads to reduced glucuronidation and elimination of anabolic steroids.

  • Elevated circulating steroids: Due to impaired elimination, biologically active steroids remain in circulation longer and at higher concentrations.

  • Increased body mass: Prolonged exposure to elevated steroid levels enhances muscle build-up, increasing body mass index.

  • Renal impact: The combination of increased body mass (causing elevated glomerular pressure and flow rate) and potential direct toxic effects of steroids on kidney tissues may lead to renal injury over time .

This hypothesis suggests that individuals with UGT2B17 gene deletion who use anabolic steroids long-term may represent a high-risk population for developing renal complications. The hypothesis has significant implications for personalized risk assessment in both therapeutic steroid use and anti-doping contexts .

How might UGT2B17 polymorphisms influence prostate cancer risk?

The relationship between UGT2B17 polymorphisms and prostate cancer risk represents an active area of research with complex and sometimes conflicting evidence . Several mechanistic pathways have been proposed:

  • Androgen metabolism alteration: Since UGT2B17 is the major enzyme for testosterone glucuronidation, its deletion polymorphism results in reduced testosterone elimination and potentially increased androgen exposure in prostate tissue.

  • Steroid hormone balance: Impaired glucuronidation may alter the balance of active androgens in the prostate, potentially influencing cellular growth and differentiation pathways associated with cancer development.

  • Environmental interactions: UGT2B17 polymorphisms might interact with environmental factors, including dietary components or medications that inhibit UGT enzymes.

Despite these plausible mechanisms, clinical studies have produced both positive and negative outcomes regarding the association between UGT2B17 deletion and prostate cancer risk . This inconsistency suggests that the relationship is complex and likely involves interactions with other genetic and environmental factors. Future research should focus on large-scale, well-controlled studies that account for these potential interactions.

What compounds are known to inhibit UGT2B17 and how might this affect endogenous and exogenous substrate metabolism?

Several compounds have been identified as inhibitors of UGT2B17 enzyme activity, with potential implications for both endogenous hormone metabolism and drug interactions:

  • Non-steroidal anti-inflammatory drugs (NSAIDs):

    • Diclofenac and ibuprofen have demonstrated inhibitory effects on testosterone glucuronidation

    • This inhibition could potentially increase circulating testosterone levels

  • Dietary components:

    • Tea extracts contain compounds that inhibit UGT2B17 activity

    • Red wine extracts have shown inhibitory effects on testosterone glucuronidation

  • Potential consequences of inhibition:

    • Increased levels of circulating testosterone and other androgens

    • Altered pharmacokinetics of drugs metabolized by UGT2B17

    • Potential exacerbation of prostate cancer risk in susceptible individuals

The inhibition of UGT2B17 by commonly consumed substances raises important considerations for drug-drug and food-drug interactions. For researchers designing clinical studies involving UGT2B17 substrates, careful consideration should be given to controlling for these potential inhibitory effects through dietary restrictions or medication reconciliation.

What are the most promising areas for future UGT2B17 research?

Based on current knowledge and unresolved questions, several high-priority research directions emerge:

  • Comprehensive characterization of substrate specificity:

    • Systematic evaluation of UGT2B17 activity across diverse chemical classes

    • Development of specific probe substrates for UGT2B17 activity assessment

    • Structural biology studies to understand substrate binding mechanisms

  • Expanded understanding of polymorphism consequences:

    • Investigation of UGT2B17 polymorphisms across diverse ethnic populations

    • Assessment of long-term health implications of UGT2B17 deficiency

    • Development of predictive models for personalizing drug therapy based on UGT2B17 genotype

  • Exploration of regulatory mechanisms:

    • Investigation of factors controlling UGT2B17 expression

    • Assessment of potential epigenetic regulation of UGT2B17

    • Evaluation of tissue-specific expression patterns and their implications

  • Clinical translation:

    • Development of clinical guidelines for drugs primarily metabolized by UGT2B17

    • Assessment of genotype-guided dosing strategies for affected medications

    • Evaluation of UGT2B17 genotyping as a component of personalized medicine approaches

These research directions would address significant knowledge gaps and potentially lead to improved therapeutic strategies and personalized medicine approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.