Recombinant Human Uncharacterized aarF domain-containing protein kinase 4 (ADCK4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Uncharacterized aarF Domain-Containing Protein Kinase 4 (ADCK4)

Recombinant Human Uncharacterized aarF Domain-Containing Protein Kinase 4 (ADCK4) is a protein associated with mitochondrial function and coenzyme Q (CoQ) biosynthesis. Despite its classification as a protein kinase, ADCK4's precise enzymatic activity remains unclear, and it is not directly involved in the CoQ biosynthetic pathway. Instead, it supports the enzymatic components necessary for CoQ synthesis, particularly in podocytes, which are crucial for kidney function .

Role of ADCK4 in Coenzyme Q Biosynthesis

ADCK4 plays a vital role in stabilizing proteins involved in the CoQ complex, including COQ5, COQ3, and COQ9. This stabilization is essential for maintaining mitochondrial function and energy production in cells, particularly in podocytes . The interaction between ADCK4 and these proteins suggests that ADCK4 may have a regulatory or supportive function in CoQ biosynthesis rather than being a direct enzyme in the pathway.

Clinical Implications of ADCK4 Deficiency

ADCK4 deficiency is associated with steroid-resistant nephrotic syndrome (SRNS), a severe kidney disorder characterized by excessive protein loss through urine. Patients with ADCK4 mutations typically present with focal segmental glomerulosclerosis (FSGS), a condition that can lead to chronic kidney disease (CKD) and end-stage renal disease (ESRD) . Unlike other mitochondrial disorders, ADCK4-related nephropathy often manifests as an isolated renal condition with minimal extrarenal symptoms .

Research Findings and Treatment Strategies

Studies have shown that ADCK4 knockout in podocytes leads to decreased CoQ10 levels, impaired mitochondrial function, and structural abnormalities in mitochondria. These defects can be partially rescued by supplementation with 2,4-dihydroxybenzoic acid (2,4-diHB), an analog of a CoQ10 precursor . Clinical trials have also demonstrated that CoQ10 supplementation can reduce proteinuria in patients with ADCK4 mutations, suggesting a potential therapeutic approach .

Data Tables: Clinical Features of ADCK4-Associated Nephropathy

The following table summarizes key clinical features of ADCK4-associated nephropathy compared to other genetic forms of SRNS:

FeatureADCK4 SRNSNPHS2 SRNSWT1 SRNS
Age at Diagnosis (Years)14.1 (10.8–17.0)3.4 (1.1–6.6)2.0 (0.7–5.4)
ProteinuriaSubnephrotic/Nephrotic: 57.1%/43.9%Subnephrotic/Nephrotic: 14.9%/85.1%Subnephrotic/Nephrotic: 19.4%/80.6%
Hematuria25.0%44.0%26.3%
Hypertension30.8%15.7%41.5%
CKD Stage 3–546.1%13.6%23.4%
Histopathological DiagnosisFSGS/Global Glomerulosclerosis: 61.5%FSGS/Global Glomerulosclerosis: 49.3%FSGS/Global Glomerulosclerosis: 45.0%

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
COQ8B; ADCK4; Atypical kinase COQ8B, mitochondrial; AarF domain-containing protein kinase 4; Coenzyme Q protein 8B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-544
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
COQ8B
Target Protein Sequence
MWLKVGGLLRGTGGQLGQTVGWPCGALGPGPHRWGPCGGSWAQKFYQDGPGRGLGEEDIR RAREARPRKTPRPQLSDRSRERKVPASRISRLANFGGLAVGLGLGVLAEMAKKSMPGGRL QSEGGSGLDSSPFLSEANAERIVQTLCTVRGAALKVGQMLSIQDNSFISPQLQHIFERVR QSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY PGIAQSIQSDVQNLLAVLKMSAALPAGLFAEQSLQALQQELAWECDYRREAACAQNFRQL LANDPFFRVPAVVKELCTTRVLGMELAGGVPLDQCQGLSQDLRNQICFQLLTLCLRELFE FRFMQTDPNWANFLYDASSHQVTLLDFGASREFGTEFTDHYIEVVKAAADGDRDCVLQKS RDLKFLTGFETKAFSDAHVEAVMILGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCP PPEETYALHRKLAGAFLACAHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSW VDPS
Uniprot No.

Target Background

Function
ADCK4, also known as an atypical kinase, plays a role in coenzyme Q (ubiquinone) biosynthesis, an essential lipid-soluble electron transporter in aerobic cellular respiration. While its substrate specificity remains unclear, it lacks protein kinase activity. It likely functions as a small molecule kinase, potentially a lipid kinase phosphorylating a prenyl lipid in the ubiquinone biosynthesis pathway. ADCK4 is also implicated in podocyte migration.
Gene References Into Functions
  1. ADCK4 mutations have been linked to reduced CoQ10 levels and mitochondrial respiratory enzyme activity in cells from individuals with steroid-resistant nephrotic syndrome and transformed lymphoblasts. PMID: 24270420
Database Links

HGNC: 19041

OMIM: 615567

KEGG: hsa:79934

STRING: 9606.ENSP00000315118

UniGene: Hs.130712

Involvement In Disease
Nephrotic syndrome 9 (NPHS9)
Protein Families
Protein kinase superfamily, ADCK protein kinase family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein. Cytoplasm, cytosol. Cell membrane.
Tissue Specificity
Widely expressed, including renal podocytes.

Q&A

What is ADCK4 and what is its primary function in human cells?

ADCK4 (aarF domain-containing protein kinase 4) is a mitochondrial protein required for coenzyme Q10 (CoQ10) biosynthesis. Research demonstrates that ADCK4 plays a crucial role in maintaining the stability of the CoQ complex and is particularly important for mitochondrial function in podocytes. Studies using mouse and cell models have confirmed that ADCK4 is required for proper CoQ10 biosynthesis, with knockout models showing significantly decreased CoQ10 levels, reduced respiratory chain activity, and diminished mitochondrial membrane potential . The protein interacts with multiple mitochondrial components, including COQ5, as well as cytoplasmic proteins such as myosin and heat shock proteins, suggesting involvement in both mitochondrial and non-mitochondrial cellular processes .

How do mutations in ADCK4 manifest clinically?

ADCK4 mutations typically manifest as steroid-resistant nephrotic syndrome (SRNS) with a predominantly renal-limited phenotype. Unlike other genetic causes of SRNS that present in early childhood, ADCK4 nephropathy characteristically presents during adolescence (median age 14.1 years) with nephrotic-range proteinuria in 44% of patients and advanced chronic kidney disease (CKD) in 46% of patients at the time of diagnosis . Renal biopsies uniformly show focal segmental glomerulosclerosis (FSGS) . While the phenotype is primarily renal, a small subset of patients may exhibit occasional seizures (three subjects), mild mental retardation (one subject), or retinitis pigmentosa (one subject) . ADCK4 nephropathy has a distinct progression pattern, with ESRD occurring almost exclusively in the second decade of life but progressing more rapidly during adolescence compared to other genetic forms of SRNS .

What is the prevalence of ADCK4 mutations among SRNS cases?

ADCK4 mutations are relatively uncommon but represent an important diagnostic consideration in adolescent-onset SRNS. In a study of 534 consecutive SRNS cases, ADCK4 mutations were identified in ten patients, yielding a mutation detection rate of 1.9% . This makes ADCK4-related glomerulopathy an important differential diagnosis in adolescents with SRNS/FSGS and/or CKD of unknown origin, particularly in consanguineous families .

What animal models are used to study ADCK4 function?

Researchers have developed several mouse models to investigate ADCK4 function. Notably, whole-body knockout of Adck4 in mice was found to be embryonically lethal, consistent with reports from the International Mouse Phenotyping Consortium . To circumvent this limitation, podocyte-specific Adck4 knockout mice have been generated by crossing Nphs2-Cre+ mice with Adck4flox/flox mice, in which two loxP sites surround exons 5 and 6 in the Adck4 gene . These podocyte-specific knockout mice develop significant kidney pathology, including severe focal segmental glomerular sclerosis (FSGS) with extensive interstitial fibrosis and tubular atrophy by 10 months of age, making them valuable models for studying ADCK4-associated nephropathy .

What cell models are utilized in ADCK4 research and how are they generated?

Two primary cell models are commonly used in ADCK4 research: human podocytes and HK2 cells (derived from human proximal tubule epithelial cells). ADCK4 knockout cell lines are typically generated using CRISPR/Cas9 technology targeting exon 6 of the ADCK4 gene . The knockout is confirmed by immunoblotting to verify the absence of ADCK4 expression. Unlike the embryonic lethality observed in whole-body knockout mice, ADCK4 knockout does not affect the viability of cultured cell lines, making them suitable for in vitro studies . These cell models enable researchers to investigate the cellular consequences of ADCK4 deficiency, including effects on CoQ10 levels, mitochondrial function, and morphology.

How can mitochondrial function be assessed in ADCK4 research?

Multiple complementary methodologies are employed to evaluate mitochondrial function in ADCK4 research:

How does ADCK4 deficiency impact the coenzyme Q complex and mitochondrial function?

ADCK4 deficiency destabilizes the coenzyme Q complex, leading to reduced CoQ10 levels with profound effects on mitochondrial structure and function. In ADCK4 knockout podocytes, significant decreases in CoQ10 levels correspond with reduced respiratory chain activity (particularly complex II+III), diminished mitochondrial membrane potential, and dysmorphic mitochondria characterized by loss of cristae formation . Interestingly, these phenotypes can be rescued by treatment with 2,4-dihydroxybenzoic acid (2,4-diHB), an analog of the CoQ10 precursor molecule, confirming that these mitochondrial defects are primarily attributable to decreased CoQ10 levels rather than other functions of ADCK4 .

The impact of ADCK4 deficiency appears to be cell-type specific. While ADCK4 knockout decreased CoQ9 levels in both podocytes and HK-2 cells, CoQ10 was reduced only in podocytes but not in HK-2 cells . This cellular specificity may partly explain the predominantly podocyte-specific pathology observed in patients with ADCK4 mutations.

What protein interactions are critical for ADCK4 function?

Proteomic analysis has revealed that ADCK4 interacts with both mitochondrial and cytoplasmic proteins. In the mitochondria, ADCK4 interacts with COQ5 and other components of the CoQ biosynthetic pathway . ADCK4 knockout decreases COQ complex levels, and importantly, the COQ5 level can be rescued by ADCK4 overexpression in ADCK4 knockout podocytes, indicating that ADCK4 plays a role in stabilizing the CoQ biosynthetic complex .

In the cytoplasm, ADCK4 interacts with myosin and heat shock proteins . These interactions may explain some phenotypes observed in ADCK4 knockout podocytes that are not rescued by 2,4-diHB supplementation, such as the shrinkage of cellular area . This suggests ADCK4 has additional cellular functions beyond its role in CoQ biosynthesis, potentially involving cytoskeletal organization and cellular stress responses.

How does disease progression in ADCK4 nephropathy compare with other genetic forms of SRNS?

This distinctive progression pattern makes ADCK4 mutations an important consideration in the differential diagnosis for adolescents with SRNS/FSGS or CKD of unknown origin, particularly when more common genetic causes have been excluded.

What proteomic approaches are used to identify ADCK4 interactors?

Two main proteomic approaches have been employed to characterize ADCK4 protein interactions:

  • Isobaric Tag for Relative and Absolute Quantification (iTRAQ): This method allows comprehensive analysis of protein abundance changes in ADCK4 knockout versus control cells. In the procedure, proteins are extracted from control and ADCK4 KO podocytes, digested with trypsin, and labeled using the 8-plex iTRAQ Labeling Kit . Fractionation of the labeled peptide mixture is performed using Agilent AdvanceBio Column and UHPLC system, followed by LC/MS/MS analysis using a Quadrupole-Orbitrap Mass Spectrometer . Data analysis using Proteome Discoverer software based on SEQUEST and percolator algorithms reveals differentially expressed proteins that can be further categorized using Gene Ontology analysis .

  • Co-immunoprecipitation Coupled with Mass Spectrometry: To identify direct ADCK4 interactors, proteins from cells stably expressing FLAG-tagged ADCK4 are incubated with FLAG M2 agarose beads, followed by elution with 3xFLAG peptide . The eluates are then analyzed by immunoblotting, Coomassie blue staining, silver staining, and NanoLC-MS/MS analysis. ProLuCID is used to identify the peptides, revealing proteins that directly interact with ADCK4 .

What strategies are effective for rescuing ADCK4 deficiency phenotypes?

Research has identified several strategies for rescuing phenotypes associated with ADCK4 deficiency:

  • 2,4-dihydroxybenzoic acid (2,4-diHB) Supplementation: This analog of the CoQ10 precursor molecule has been shown to effectively prevent focal segmental glomerular sclerosis, interstitial fibrosis, and tubular atrophy in podocyte-specific Adck4 knockout mice . In cell culture models, 2,4-diHB treatment rescues decreased CoQ10 levels, reduced respiratory chain activity, diminished mitochondrial potential, and dysmorphic mitochondria in ADCK4 knockout podocytes .

  • ADCK4 Overexpression: Reintroduction of ADCK4 expression in knockout cells can rescue certain phenotypes, particularly the reduction in COQ5 levels, suggesting that gene replacement strategies might be therapeutically viable .

  • CoQ10 Supplementation: Direct CoQ10 supplementation has been attempted in patients with ADCK4 mutations with variable success . The partial response to CoQ10 supplementation in some patients suggests that early intervention before irreversible kidney damage occurs may be crucial for treatment efficacy.

It's important to note that not all phenotypes can be rescued by these approaches. For example, the shrinkage of cellular area in ADCK4 knockout podocytes is not restored by 2,4-diHB supplementation, indicating that ADCK4 has additional cellular functions beyond CoQ biosynthesis .

What mutational spectrum is observed in ADCK4-associated nephropathy?

The mutational spectrum of ADCK4 includes both previously reported and novel variants. Analysis of patients with ADCK4-associated nephropathy has revealed several key mutations:

  • Previously reported homozygous mutations include c.645delT, c.1199_1200dupA, and c.532C>T (p.Arg178Trp) .

  • Novel variants have also been identified, including c.1339dupG, which was found in four apparently unrelated Kurdish families originating from a region in southeast Turkey, suggesting a possible founder effect .

The mutation detection rate is approximately 1.9% among consecutively screened SRNS cases, making it an important consideration in the genetic diagnosis of steroid-resistant nephrotic syndrome, particularly in adolescent-onset cases .

How should researchers approach experimental design when studying ADCK4 function in different cell types?

When designing experiments to study ADCK4 function, researchers should consider the cell-type specific effects of ADCK4 deficiency. Evidence suggests that ADCK4 plays a particularly important role in podocytes compared to other cell types. For example, while ADCK4 knockout decreased CoQ9 in both cultured podocytes and HK-2 cells, CoQ10 was reduced only in podocytes . Similarly, mitochondrial membrane potential was significantly reduced in ADCK4 knockout podocytes but not in HK-2 cells .

Researchers should also consider the potential impact of environmental factors and cellular stress on ADCK4-deficient cells. ADCK4 knockout podocytes show increased sensitivity to arachidonic acid (AA) treatment, with more severe mitochondrial defects and cellular area shrinkage compared to control cells . This suggests that ADCK4 deficiency may sensitize cells to certain types of stress, which could be an important factor in disease pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.