Recombinant Human Uncharacterized aarF domain-containing protein kinase 5 (ADCK5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ADCK5; Uncharacterized aarF domain-containing protein kinase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-580
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
ADCK5
Target Protein Sequence
MWRPVQLCHFHSALLHRRQKPWPSPAVFFRRNVRGLPPRFSSPTPLWRKVLSTAVVGAPL LLGARYVMAEAREKRRMRLVVDGMGRFGRSLKVGLQISLDYWWCTNVVLRGVEENSPGYL EVMSACHQRAADALVAGAISNGGLYVKLGQGLCSFNHLLPPEYTRTLRVLEDRALKRGFQ EVDELFLEDFQALPHELFQEFDYQPIAAASLAQVHRAKLHDGTSVAVKVQYIDLRDRFDG DIHTLELLLRLVEVMHPSFGFSWVLQDLKGTLAQELDFENEGRNAERCARELAHFPYVVV PRVHWDKSSKRVLTADFCAGCKVNDVEAIRSQGLAVHDIAEKLIKAFAEQIFYTGFIHSD PHPGNVLVRKGPDGKAELVLLDHGLYQFLEEKDRAALCQLWRAIILRDDAAMRAHAAALG VQDYLLFAEMLMQRPVRLGQLWGSHLLSREEAAYMVDMARERFEAVMAVLRELPRPMLLV LRNINTVRAINVALGAPVDRYFLMAKRAVRGWSRLAGATYRGVYGTSLLRHAKVVWEMLK FEVALRLETLAMRLTALLARALVHLSLVPPAEELYQYLET
Uniprot No.

Target Background

Function

The function of Recombinant Human Uncharacterized aarF domain-containing protein kinase 5 (ADCK5) remains unclear. Its protein kinase activity and potential substrate (Ser, Thr, or Tyr) phosphorylation have yet to be determined.

Database Links

HGNC: 21738

KEGG: hsa:203054

STRING: 9606.ENSP00000310547

UniGene: Hs.283374

Protein Families
Protein kinase superfamily, ADCK protein kinase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What experimental strategies confirm ADCK5’s kinase activity and substrate specificity?

To validate ADCK5’s predicted serine/threonine kinase function, researchers should implement a three-phase approach:

  • In vitro kinase assays: Incubate purified recombinant ADCK5 with synthetic peptides containing serine, threonine, or tyrosine residues under ATP-rich conditions. Use radioactive γ-32P-ATP or anti-phosphoantibodies for phosphorylation detection .

  • Mass spectrometry-based substrate screening: Combine ADCK5 with tissue lysates (e.g., lung or duodenum ) followed by phosphoproteomic analysis to identify natural substrates .

  • Structural validation: Perform X-ray crystallography or cryo-EM to resolve the ATP-binding pocket conformation and catalytic loop geometry .

Table 1: Key parameters for kinase activity assays

ComponentRecommended SpecificationsPurpose
Recombinant ADCK50.5-1 µg/µL in 50 mM Tris-HCl (pH 7.5)Enzyme source
Substrate peptides10-mer sequences with S/T/Y motifsPhosphorylation targets
Detection methodAnti-pSer/Thr antibodies (1:1000)Specific phosphorylation imaging

How does ADCK5 tissue expression variability impact functional studies?

ADCK5 displays differential expression across tissues, with highest levels observed in the duodenum (FPKM 15.7) versus moderate expression in lung (FPKM 8.3) . Researchers must:

  • Normalize cellular models: Use intestinal organoids or lung adenocarcinoma lines (e.g., A549) for pathophysiological relevance

  • Control for isoform diversity: Perform RT-PCR with exon-spanning primers to detect alternative splicing variants

  • Correlate expression with activity: Quantify kinase activity per µg protein across tissue lysates using standardized protocols

What computational and experimental approaches resolve ADCK5’s structure-function paradoxes?

Despite sequence homology to atypical kinase family members, ADCK5 lacks conserved catalytic residues in 38% of kinase subdomains . Address this through:

Integrative molecular modeling

  • Build homology models using Phyre2 with ADCK3 (template 4WNU) as reference

  • Perform molecular dynamics simulations (200 ns trajectories) to assess ATP-binding stability

  • Validate critical residues (e.g., Lys-209 in β3 sheet) via site-directed mutagenesis

Experimental validation workflow:

  • Clone ADCK5 mutants (K209A, D227N) into baculovirus vectors

  • Compare wild-type vs mutant kinase activity in HEK293T overexpression systems

  • Analyze structural impacts via circular dichroism spectroscopy

How can phosphoproteomic data reconcile contradictory reports on ADCK5 signaling roles?

Recent studies propose ADCK5 involvement in both ERK5-mediated senescence and Wnt/β-catenin pathways , creating mechanistic ambiguity. A multi-omics strategy is essential:

  • Time-resolved phosphoproteomics: Treat ADCK5-knockout cells with serum growth factors, collecting samples at 0/15/60/240 min for LC-MS/MS analysis

  • Pathway enrichment analysis: Map phosphorylated substrates to KEGG pathways using STRING-db (FDR <0.05)

  • Functional validation: CRISPRi knockdown of top candidate substrates (e.g., MAPK12) followed by senescence-associated β-galactosidase assays

Table 2: Conflicting ADCK5 pathway associations

Proposed PathwaySupporting EvidenceContradictory Findings
ERK5-Senescence AxisCo-regulation in melanoma models No direct phosphorylation observed
Wnt/β-catenin SignalingChromosomal proximity to TCF7L2 Lack of β-catenin stabilization

What orthogonal methods validate ADCK5’s therapeutic potential in lung cancer?

While preliminary data suggest ADCK5 overexpression correlates with NSCLC progression , rigorous validation requires:

Preclinical candidate assessment

  • Genetic dependency screens: Perform shRNA dropout assays in 50+ lung cancer lines (Broad Institute DepMap)

  • Chemical probe development: Screen 10,000-compound libraries against recombinant ADCK5 using HTRF kinase assays

  • In vivo modeling: Generate conditional ADCK5 knockout mice crossed with KRASG12D lung adenocarcinoma models

Key validation metrics:

  • Tumor burden reduction ≥40% in knockout vs wild-type

  • IC50 shift <2-fold in isogenic cell pairs with ADCK5 overexpression

  • Phospho-substrate signature replication in patient-derived xenografts

Addressing the kinase activity controversy

The central dispute stems from conflicting reports on ADCK5’s catalytic competence . A recommended resolution pathway includes:

  • Standardized activity assays:

    • Consensus buffer: 20 mM HEPES (pH 7.4), 10 mM MgCl2, 1 mM DTT

    • Positive control: Active MAPK7 (ERK5) at 100 nM concentration

    • Negative control: Heat-denatured ADCK5 (65°C, 10 min)

  • Phosphoacceptor scanning: Synthesize peptide arrays with systematic Ser→Ala substitutions to identify essential residues

  • Collaborative validation: Establish multi-lab reproducibility studies through CASP kinase challenge initiatives

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.