Recombinant Human Uncharacterized membrane protein C19orf24 (C19orf24)

Shipped with Ice Packs
In Stock

Description

Expression and Tissue Specificity

C19orf24 exhibits restricted tissue expression, primarily in the human liver .

TissueExpression PatternPathological RelevanceSource
LiverPredominant expression in normal tissuePreferential expression in non-diseased states
RetinoblastomaDetected in RNA fusion events (CIRBP-C19orf24)Associated with tumor development
RectumLimited expression in rectal cell typesNo reported clinical significance

Notably, C19orf24 is absent in other organs, and its expression declines in pathological conditions, suggesting a role in maintaining normal cellular homeostasis .

Evolutionary Aspects

C19orf24 emerged recently under purifying selection, indicating functional conservation in primates .

Evolutionary TraitDescriptionSource
Species DistributionExclusive to Homo sapiens and Pan troglodytes
Selection PressureHigh synonymous/non-synonymous substitution ratio
Functional ConservationNo paralogs; unique secretion mechanism

This evolutionary profile implies a specialized, irreplaceable role in human physiology .

  • Structural Biology: Crystallization studies to resolve secretion mechanisms .

  • Immunoassays: ELISA and Western blotting for protein detection .

  • Functional Studies: Investigation of non-classical secretion pathways .

Clinical and Pathological Relevance

C19orf24 has been implicated in two distinct clinical contexts:

ContextObservationImplicationSource
RetinoblastomaCIRBP-C19orf24 RNA fusion detected in 31% of tumorsPotential oncogenic driver
MicrodeletionsDeletions spanning C19orf24, CIRBP, and EFNA2 observed in developmental disordersLinked to microcephaly and neurological deficits

These findings highlight C19orf24’s potential role in tumorigenesis and neurodevelopmental disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAM174C; C19orf24; Protein FAM174C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-132
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
C19orf24
Target Protein Sequence
EEASPLRPAQVTLSPPPAVTNGSQPGAPHNSTHTRPPGASGSALTRSFYVILGFCGLTAL YFLIRAFRLKKPQRRRYGLLANTEDPTEMASLDSDEETVFESRNLR
Uniprot No.

Target Background

Gene References Into Functions
  1. This study reports the isolation and characterization of a novel human non-classical secreted protein encoded by the hypothetical gene C19orf24 (chromosome 19 open reading frame 24). PMID: 16847563
Database Links

HGNC: 26073

KEGG: hsa:55009

STRING: 9606.ENSP00000386557

UniGene: Hs.591383

Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is C19orf24 and what are its fundamental characteristics?

C19orf24 (chromosome 19 open reading frame 24) encodes a novel non-classical secreted protein in humans. Unlike conventional secreted proteins, it lacks a signal peptide but can still be secreted extracellularly, even in the presence of brefeldin A (BFA), which typically inhibits classical protein secretion pathways . This unique characteristic places it in the category of non-classical secreted proteins. The protein does not undergo N-glycosylation modification, as verified through deglycosylation analysis with PNGase F . C19orf24 maps to chromosome 19p13.3 in humans and represents a protein of significant evolutionary interest .

What is known about the evolutionary history of C19orf24?

C19orf24 has been identified as a recently evolved gene found only in Homo sapiens and Pan troglodytes (chimpanzees), making it a relatively new addition to the primate genome . Evolutionary analysis through calculation of synonymous and non-synonymous substitution rates (dS/dN) indicates that the gene has experienced purifying selection . This selective pressure suggests that despite its recent emergence, C19orf24 likely serves a specialized, irreplaceable biological function in humans and our closest evolutionary relatives. The identification of a C19orf24 homolog in Protobothrops mucrosquamatus (Taiwan habu snake) suggests potential functional conservation across more distant vertebrate species, though the functional equivalence requires further investigation .

What is the tissue expression pattern of C19orf24?

Experimental evidence from reverse transcription-PCR analyses demonstrates that C19orf24 exhibits highly specific tissue expression, being detected only in human liver tissue . Furthermore, the protein shows preferential expression in normal liver tissue compared to diseased states, suggesting potential regulatory mechanisms associated with liver health . This restricted expression pattern provides important clues about its potential functional role and should inform experimental design when studying this protein.

How does C19orf24 achieve extracellular secretion without a signal peptide?

C19orf24 utilizes a non-classical secretion pathway that operates independently of the typical signal peptide-driven mechanisms. Experimental evidence shows that C19orf24 secretion persists even in the presence of brefeldin A (BFA), an inhibitor that disrupts conventional protein transport from the endoplasmic reticulum to the Golgi apparatus . This demonstrates that C19orf24 employs an alternative secretion mechanism. Subcellular localization studies using C19orf24 in vivo and transfected pEYFP-Golgi plasmid in HeLa cells revealed that C19orf24 does not co-localize with the Golgi apparatus, further confirming its non-conventional secretory route .

What experimental approaches are recommended for tracking C19orf24 secretion?

Based on published methodologies, researchers investigating C19orf24 secretion should consider:

  • BFA inhibition assays: Comparing protein secretion levels in culture media with and without BFA treatment to confirm non-classical secretion

  • Subcellular co-localization studies: Using fluorescently tagged C19orf24 alongside organelle markers (particularly for Golgi apparatus) to track intracellular trafficking

  • Fractionation of cell lysates (CL) and culture media (CM): Separating and analyzing protein content in both cellular and secreted fractions

  • Deglycosylation analysis: Employing PNGase F treatment to assess potential glycosylation modifications

These combined approaches provide comprehensive insights into the secretory behavior of this unconventional protein.

What CRISPR/Cas9 tools are available for C19orf24 research?

Several CRISPR/Cas9 tools have been developed specifically for C19orf24 gene targeting:

  • The Zhang laboratory at the Broad Institute has designed gRNA sequences uniquely targeting the C19orf24 gene with minimal off-target effects . These validated sequences provide an excellent starting point for gene editing experiments.

  • Commercial CRISPR/Cas9 knockout plasmids are available, such as the Santa Cruz Biotechnology C19orf24 CRISPR/Cas9 KO Plasmid (h) that contains a pool of three plasmids, each encoding the Cas9 nuclease and target-specific 20 nt guide RNA designed for maximum knockout efficiency . These plasmids are specifically designed to create a double-strand break in a 5' constitutive exon of the C19orf24 gene.

The availability of these validated tools significantly facilitates functional studies through targeted gene disruption.

What experimental design considerations are important when generating C19orf24 knockout models?

When designing C19orf24 knockout experiments, researchers should consider:

  • Guide RNA selection: While a single gRNA construct may be sufficient, ordering at least two gRNA constructs per target gene is recommended to increase success rates . Researchers should verify gRNA sequences against their specific target sequence, particularly if targeting specific splice variants or exons.

  • Validation strategies: Given the liver-specific expression of C19orf24, validation of knockout efficiency should include assessment of both genomic modifications and expression levels in appropriate cell models that naturally express the protein .

  • Phenotypic analysis: Due to the purifying selection observed for C19orf24, knockout models may reveal significant phenotypes related to its specialized function . Comprehensive phenotypic screening focusing on liver functions would be particularly valuable.

  • Controls: Appropriate controls should include wild-type cells and cells transfected with non-targeting gRNAs to distinguish between specific effects of C19orf24 knockout and potential off-target or transfection-related effects .

How can researchers investigate the potential functional role of C19orf24 based on its evolutionary characteristics?

The evolutionary profile of C19orf24 provides important clues for functional investigation:

  • Comparative functional studies between human and chimpanzee C19orf24 may reveal species-specific adaptations . The high conservation between these species despite recent evolution suggests functionally important roles.

  • Analysis of purifying selection patterns across different protein domains can help identify functionally critical regions. Regions under strongest selective constraint likely represent essential functional or structural elements .

  • Examination of the C19orf24 homolog in Protobothrops mucrosquamatus offers an opportunity to explore functional conservation across distantly related species . Expression of both proteins in comparable systems could reveal conserved or divergent functions.

  • Given its recent evolutionary emergence, investigation of genomic context and potential co-evolution with interacting partners may provide insights into its functional niche.

What methods are recommended for investigating C19orf24 binding partners and functional networks?

To elucidate the functional networks involving C19orf24, researchers should consider:

  • Proximity-dependent biotin identification (BioID) or ascorbate peroxidase (APEX) proximity labeling: These approaches are particularly suitable for potentially transient interactions occurring during non-classical secretion.

  • Co-immunoprecipitation coupled with mass spectrometry: For identifying stable binding partners, with special consideration of liver-specific interactors given its tissue-specific expression .

  • Yeast two-hybrid screening: A complementary approach that may identify additional interactors, though verification in mammalian systems would be essential.

  • Liver-specific interactome analysis: Given the restricted expression pattern, focusing on liver-specific protein networks may be particularly informative .

  • Secretome analysis: Comparing the secreted protein profiles of cells with normal versus knocked-down/out C19orf24 expression to identify downstream effects on protein secretion.

What are the major challenges in recombinant C19orf24 production and how can they be addressed?

Production of recombinant C19orf24 presents several challenges:

  • Non-classical secretion mechanism: The unconventional secretion pathway may complicate production systems that rely on standard secretion signals . Potential solutions include:

    • Testing multiple expression systems (bacterial, insect, mammalian)

    • Using liver-derived cell lines that naturally process C19orf24

    • Employing fusion tags that facilitate secretion or purification

  • Protein solubility and stability: As a membrane-associated protein, C19orf24 may present solubility challenges . Strategies to address this include:

    • Optimization of detergent conditions

    • Use of solubility-enhancing fusion partners like thioredoxin (TRX)

    • Testing truncated constructs to identify soluble domains

  • Functional validation: Confirming that recombinant C19orf24 retains native functionality. Approaches include:

    • Comparing subcellular localization with native protein

    • Assessing secretion patterns in the presence of BFA

    • Performing functional complementation in knockout models

What experimental systems and resources are available for C19orf24 research?

Resource TypeAvailable OptionsApplicationsSource Reference
CRISPR/Cas9 ToolsZhang Lab gRNA designsGene knockout, mutation
Santa Cruz KO Plasmid poolGene knockout
Expression VectorspcDNA3.1-C-(k)DYKRecombinant expression
pEYFP-Golgi plasmidLocalization studies
Detection MethodsReverse transcription-PCRExpression analysis
Deglycosylation analysisPost-translational modification
Homologous SystemsHuman C19orf24Primary research target
Chimpanzee C19orf24Comparative studies
Snake CUNH19orf24 homologEvolutionary studies

What are the key experimental findings regarding C19orf24 processing and modifications?

FeatureFindingExperimental MethodImplicationSource
Signal PeptideAbsentSequence analysisNon-classical secretion
Secretion MechanismBFA-resistantBFA inhibition assayNovel secretory pathway
Golgi LocalizationDoes not co-localizeFluorescent co-localizationAlternative trafficking route
N-GlycosylationAbsentPNGase F deglycosylationLimited post-translational modification
Tissue ExpressionLiver-specificRT-PCRSpecialized function in liver
Evolutionary StatusRecently evolvedComparative genomicsHuman/chimp-specific functions
Selection PressurePurifying selectiondS/dN ratio calculationFunctionally important

This comprehensive collection of questions and methodological answers provides a framework for researchers investigating C19orf24, from basic characterization to advanced functional studies. The unique characteristics of this protein—including its recent evolutionary emergence, non-classical secretion mechanism, and liver-specific expression—make it a fascinating subject for fundamental research into protein evolution and unconventional secretory pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.