Recombinant Human Uncharacterized protein ATPAF1-AS1 (ATPAF1-AS1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Human Uncharacterized Protein ATPAF1-AS1 (ATPAF1-AS1)

Recombinant Human Uncharacterized protein ATPAF1-AS1, encoded by the ATPAF1-AS1 gene, is a protein that has been identified as a potential tumor suppressor gene (TSG) . It is also known as ATP synthase mitochondrial F1 complex assembly factor 1 . The protein is involved in the assembly of the F1 component of the mitochondrial ATP synthase .

Gene Information

The ATPAF1 gene encodes an assembly factor crucial for the F1 component of mitochondrial ATP synthase . This protein specifically binds to the F1 beta subunit . It is believed to prevent the formation of nonproductive homooligomers of this subunit during enzyme assembly . Alternative splicing of this gene results in multiple transcript variants .

Aliases for ATPAF1 Gene :

  • ATPF1

External IDs for ATPAF1 Gene :

  • HGNC: 18803

  • NCBI Gene: 64756

  • Ensembl: ENSG00000123472

  • OMIM®: 608917

  • UniProtKB/Swiss-Prot: Q5TC12

Function and Structure of ATPAF1

ATPAF1 plays a vital role in the assembly of the mitochondrial F1-F0 complex . The F1 portion of ATP synthase is hydrophilic and hydrolyzes ATP . It consists of α and β subunits, which form a hexamer with six binding sites . Three of these sites are catalytically inactive and bind ADP, while the other three catalyze ATP synthesis . Subunits γ, δ, and ε are part of a rotational motor mechanism . The γ subunit induces conformational changes in β, facilitating ATP binding and release .

Role in ATP Synthase

ATP synthase, located in the inner mitochondrial membrane, consists of two regions: F$$$$O and F$$$$1 . The F$$$$O region causes the rotation of F$$$$1 and is composed of a c-ring and subunits a, two b, and F6 . The F$$_$$1 region is made of α, β, γ, and δ subunits . ATP synthase facilitates the movement of protons across the membrane .

Clinical Significance

Diseases associated with ATPAF1 include Isolated ATP Synthase Deficiency and Powassan Encephalitis . ATPAF1-AS1 and MAP3K6 have been identified as potential tumor suppressor genes in familial pancreatic cancer .

ATPAF1 in Cancer

Integrative approaches have identified ATPAF1-AS1 as a potential tumor suppressor gene . Germline variants of ATPAF1-AS1 have been confirmed by Sanger sequencing and somatic fluorescence in-situ hybridization .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
TEX38; ATPAF1-AS1; C1orf223; Testis-expressed protein 38; ATPAF1 antisense RNA 1; ATPAF1 antisense gene protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TEX38
Target Protein Sequence
MDSQQEDLRFPGMWVSLYFGILGLCSVITGGCIIFLHWRKNLRREEHAQQWVEVMRAATF TYSPLLYWINKRRRYGMNAAINTGPAPAVTKTETEVQNPDVLWDLDIPEGRSHADQDSNP KAEAPAPLQPALQLAPQQPQARSPFPLPIFQEVPFAPPLCNLPPLLNHSVSYPLATCPER NVLFHSLLNLAQEDHSFNAKPFPSEL
Uniprot No.

Target Background

Database Links

HGNC: 29589

KEGG: hsa:374973

STRING: 9606.ENSP00000456635

UniGene: Hs.443299

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is ATPAF1-AS1 and how does it relate to ATPAF1?

ATPAF1-AS1 is an antisense RNA that is transcribed from the opposite strand of the ATPAF1 gene locus. While ATPAF1 encodes the ATP synthase mitochondrial F1 complex assembly factor 1, which is essential for the proper assembly of the F1 component of mitochondrial ATP synthase , ATPAF1-AS1 is a non-coding RNA that may potentially regulate ATPAF1 expression through various mechanisms.

Antisense RNAs typically function by binding to their sense counterparts, potentially affecting their stability, translation, or processing. Methodologically, researchers should approach ATPAF1-AS1 by first examining its expression patterns in relation to ATPAF1 across different tissues and under various physiological conditions, employing techniques such as quantitative RT-PCR, RNA-seq, and in situ hybridization.

What is known about the expression patterns of ATPAF1 that might inform ATPAF1-AS1 research?

ATPAF1 shows nearly constant expression across various tissues in both adult and developing mice (5-day-old), suggesting ubiquitous importance . This widespread expression pattern suggests that ATPAF1-AS1 may also be expressed in multiple tissues, though potentially with tissue-specific regulation patterns.

To study ATPAF1-AS1 expression in relation to ATPAF1, researchers should:

  • Perform parallel quantitative RT-PCR analyses of both transcripts across tissue panels

  • Analyze publicly available RNA-seq datasets for co-expression patterns

  • Investigate potential inverse expression relationships that might suggest regulatory functions

  • Examine expression under conditions known to affect mitochondrial function or ATP synthesis

What are the known cellular functions of ATPAF1 that might suggest potential roles for ATPAF1-AS1?

ATPAF1 serves as a crucial assembly factor for the F1 component of mitochondrial ATP synthase. It specifically binds to the F1 beta subunit, preventing the formation of nonproductive homooligomers during enzyme assembly . Knockout studies in mice have demonstrated that ATPAF1 deficiency leads to:

  • Decreased ATP synthase content and function

  • Mitochondrial ultrastructural abnormalities including condensed degenerated mitochondria and loss of cristae

  • Impaired respiratory capacity

  • Cardiac dysfunction with left ventricle hypertrophy and remodeling

ATPAF1-AS1 might therefore play a role in regulating these processes by modulating ATPAF1 expression, particularly under stress conditions or during developmental stages with high energy demands.

What experimental approaches would be most effective for characterizing the function of ATPAF1-AS1?

For characterizing ATPAF1-AS1 function, a multi-faceted approach is recommended:

  • Knockdown/Overexpression Studies:

    • Use siRNA or antisense oligonucleotides targeting ATPAF1-AS1

    • Create CRISPR/Cas9-mediated knockout cell lines

    • Engineer inducible expression systems for controlled ATPAF1-AS1 overexpression

  • Interaction Analysis:

    • RNA immunoprecipitation (RIP) to identify protein partners

    • RNA pull-down assays followed by mass spectrometry

    • CHART (Capture Hybridization Analysis of RNA Targets) to identify genomic binding sites

  • Functional Impact Assessment:

    • Measure ATPAF1 mRNA and protein levels following ATPAF1-AS1 modulation

    • Assess ATP synthase assembly using Blue-Native electrophoresis (BN-PAGE)

    • Evaluate mitochondrial function parameters:

      • Oxygen consumption rate

      • ATP production

      • Mitochondrial membrane potential

      • Mitochondrial morphology

  • Tissue-Specific Analysis:

    • Focus particularly on heart tissue, given the established importance of ATPAF1 in cardiac function

    • Compare high-energy demanding tissues with those having lower energy requirements

How might ATPAF1-AS1 potentially impact mitochondrial ATP synthase assembly and function?

Based on the established role of ATPAF1, ATPAF1-AS1 could influence ATP synthase assembly and function through several mechanisms:

  • Transcriptional Regulation: ATPAF1-AS1 might modulate ATPAF1 expression by interfering with transcription factor binding or recruiting chromatin modifiers to the ATPAF1 locus.

  • Post-transcriptional Regulation: ATPAF1-AS1 could influence ATPAF1 mRNA stability, splicing, or nuclear export.

  • Translational Control: By binding to ATPAF1 mRNA, ATPAF1-AS1 might inhibit or enhance translation.

  • Indirect Pathways: ATPAF1-AS1 might regulate other factors involved in mitochondrial biogenesis or ATP synthase assembly.

Experimental approaches to investigate these possibilities should include:

  • RNA-protein complex immunoprecipitation to identify ATPAF1-AS1 binding partners

  • Polysome profiling to assess translational impacts

  • In-gel ATPase activity assays following ATPAF1-AS1 modulation, similar to methods used for ATPAF1 studies

What is the potential relationship between ATPAF1-AS1 and disease states associated with mitochondrial dysfunction?

Given that ATPAF1 deficiency leads to cardiac dysfunction in mouse models and mitochondrial ATP synthase deficiencies are associated with various human diseases, ATPAF1-AS1 could potentially play a role in:

  • Cardiomyopathies: The established link between ATPAF1 and cardiac function suggests ATPAF1-AS1 dysregulation might contribute to heart failure or cardiomyopathies.

  • Neurodegenerative Disorders: ATP synthase deficiencies are associated with conditions like Leigh syndrome , suggesting potential ATPAF1-AS1 involvement in neurological disorders.

  • Metabolic Diseases: Given the central role of ATP production in metabolism, ATPAF1-AS1 might influence metabolic disorders.

  • Aging-Related Pathologies: Mitochondrial dysfunction is a hallmark of aging, making ATPAF1-AS1 a potential factor in age-related decline.

Methodological approaches should include:

  • Analysis of ATPAF1-AS1 expression in patient-derived tissues

  • Correlation studies between ATPAF1-AS1 expression levels and disease severity

  • Development of disease models with altered ATPAF1-AS1 expression

What are the optimal methods for producing recombinant ATPAF1-AS1 for research applications?

For producing recombinant ATPAF1-AS1:

  • In vitro Transcription:

    • Clone ATPAF1-AS1 sequence downstream of a T7 or SP6 promoter

    • Perform in vitro transcription with appropriate RNA polymerase

    • Purify using gel electrophoresis or commercial RNA purification kits

    • Consider incorporating modified nucleotides for stability if needed

  • Expression in Bacterial Systems:

    • For studies requiring large amounts of ATPAF1-AS1

    • Clone into expression vectors with inducible promoters

    • Express in appropriate bacterial strains (e.g., Rosetta for rare codon optimization)

    • Perform RNA extraction under conditions that minimize RNase activity

  • Quality Control:

    • Verify size and integrity by denaturing gel electrophoresis

    • Confirm sequence by reverse transcription and sequencing

    • Assess purity by spectrophotometric analysis (A260/A280 ratio)

  • Storage and Handling:

    • Store in RNase-free conditions with RNase inhibitors

    • Aliquot to avoid freeze-thaw cycles

    • Consider addition of carrier RNA for dilute solutions

What detection and quantification methods are most suitable for ATPAF1-AS1 in experimental settings?

For detecting and quantifying ATPAF1-AS1 in experimental settings:

  • Quantitative RT-PCR:

    • Design strand-specific primers that distinguish ATPAF1-AS1 from ATPAF1 mRNA

    • Implement strict controls for specificity validation

    • Use appropriate reference genes for normalization

  • Northern Blotting:

    • Provides size information and specificity

    • Design probes specifically targeting ATPAF1-AS1

    • Include controls to verify strand specificity

  • RNA Fluorescence In Situ Hybridization (RNA-FISH):

    • For visualizing subcellular localization

    • Design probes that specifically recognize ATPAF1-AS1

    • Combine with immunofluorescence for co-localization studies

  • RNA-Seq:

    • Implement strand-specific library preparation protocols

    • Apply computational pipelines optimized for antisense transcript detection

    • Validate findings with other methods due to potential mapping ambiguities

How should researchers design experiments to study potential regulatory interactions between ATPAF1-AS1 and ATPAF1?

To investigate regulatory interactions between ATPAF1-AS1 and ATPAF1:

  • Expression Correlation Analysis:

    • Measure both transcripts across:

      • Different cell types and tissues

      • Developmental stages

      • Stress conditions (especially mitochondrial stress)

    • Look for inverse correlation patterns suggestive of regulatory relationships

  • Direct Interaction Studies:

    • Perform RNA-RNA interaction assays (e.g., RNA antisense purification)

    • Use tagged RNA molecules to pull down potential complexes

    • Implement cross-linking methods to capture transient interactions

  • Functional Impact Assessment:

    • Modulate ATPAF1-AS1 levels and monitor effects on:

      • ATPAF1 mRNA levels and stability

      • ATPAF1 protein expression

      • ATP synthase assembly (using BN-PAGE as in ATPAF1 studies )

      • Mitochondrial function parameters

  • Mechanism Exploration:

    • Investigate chromatin modifications at the ATPAF1 locus following ATPAF1-AS1 manipulation

    • Examine recruitment of regulatory proteins to the ATPAF1/ATPAF1-AS1 genomic region

    • Assess potential impacts on ATPAF1 mRNA processing, export, and translation

What animal models would be most appropriate for studying ATPAF1-AS1 function in vivo?

Based on the known importance of ATPAF1 in cardiac function and development , the following animal models would be appropriate:

  • Mouse Models:

    • CRISPR/Cas9-generated ATPAF1-AS1 knockout mice

    • Conditional knockout models using tissue-specific promoters

    • Transgenic overexpression models

    • Consider cardiac-specific manipulations given the established importance of ATPAF1 in heart function

  • Experimental Approaches:

    • Echocardiography to assess cardiac function

    • Mitochondrial isolation and respiratory capacity measurements

    • Blue-Native PAGE for ATP synthase assembly analysis

    • Electron microscopy for mitochondrial ultrastructure examination

  • Developmental Studies:

    • Examine embryonic lethality patterns (noting that ATPAF2-KO was embryonically lethal while ATPAF1-KO mice survived to adulthood but with smaller body sizes )

    • Investigate tissue-specific expression patterns during development

    • Study compensatory mechanisms in ATPAF1-AS1 knockout models

  • Disease Models:

    • Cardiac stress models (e.g., pressure overload, ischemia-reperfusion)

    • Metabolic challenge models (e.g., high-fat diet)

    • Aging studies to assess long-term effects

What are the most promising avenues for future research on ATPAF1-AS1?

Future research on ATPAF1-AS1 should focus on:

  • Comprehensive Expression Profiling:

    • Create a detailed atlas of ATPAF1-AS1 expression across tissues, developmental stages, and disease states

    • Compare with ATPAF1 expression patterns to identify potential regulatory relationships

    • Investigate subcellular localization patterns

  • Functional Characterization:

    • Determine the impact of ATPAF1-AS1 on ATPAF1 expression and function

    • Investigate effects on ATP synthase assembly and activity

    • Explore broader impacts on mitochondrial function and cellular energy metabolism

  • Mechanistic Studies:

    • Identify protein binding partners of ATPAF1-AS1

    • Determine the structural features of ATPAF1-AS1 critical for its function

    • Investigate epigenetic regulation of the ATPAF1/ATPAF1-AS1 locus

  • Therapeutic Potential:

    • Explore ATPAF1-AS1 as a potential target for disorders involving mitochondrial dysfunction

    • Investigate therapeutic approaches for modulating ATPAF1-AS1 expression or function

    • Develop biomarkers based on ATPAF1-AS1 expression for mitochondrial diseases

How might high-throughput technologies advance our understanding of ATPAF1-AS1?

High-throughput technologies offer several approaches to advance ATPAF1-AS1 research:

  • Single-Cell RNA-Seq:

    • Reveal cell-type specific expression patterns

    • Identify potential regulatory relationships at single-cell resolution

    • Discover rare cell populations with unique ATPAF1-AS1 expression patterns

  • CRISPR Screening:

    • Perform genome-wide CRISPR screens to identify factors affecting ATPAF1-AS1 expression

    • Screen for genes whose disruption creates synthetic lethality with ATPAF1-AS1 modulation

    • Identify regulatory elements controlling ATPAF1-AS1 expression

  • Proteomics Approaches:

    • Identify proteins interacting with ATPAF1-AS1 using RNA-protein interaction screens

    • Analyze changes in the mitochondrial proteome following ATPAF1-AS1 manipulation

    • Study post-translational modifications affected by ATPAF1-AS1 expression

  • Structural Biology:

    • Determine the secondary and tertiary structure of ATPAF1-AS1

    • Characterize structural features important for function

    • Visualize potential ATPAF1-AS1:ATPAF1 mRNA interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.