Recombinant Human Uncharacterized protein C10orf111 (C10orf111)

Shipped with Ice Packs
In Stock

Description

Identification and Interactions

C10orf111, also known as C10orf12, has been identified as an interactor with the Polycomb Repressive Complex 2 (PRC2) . The PRC2 complex is crucial for gene silencing during development in higher organisms, maintaining the fidelity of gene expression .

  • BioTAP-XL Approach A method called BioTAP-XL, which involves cross-linking and affinity purification, has been developed to identify protein-protein interactions while the complexes remain linked to DNA . This approach has facilitated the study of C10orf111 and its interactions with PRC2 .

  • Reciprocal Interactions Studies using BioTAP pulldowns on tagged versions of C10orf111 have shown that C10orf111 recovers core members of the PRC2 complex, such as EZH2, EED, and SUZ12, among the top significantly interacting proteins .

  • Genome-Wide Patterns Chromatin immunoprecipitation sequencing (ChIP-seq) analyses of tagged C10orf111 show genome-wide patterns of enrichment domains that closely match those of EZH2 and H3K27me3 . This further supports the role of C10orf111 as an authentic interactor with the PRC2 complex .

C11orf96: A Related Protein

While the primary focus is C10orf111, it is important not to confuse it with C11orf96, another uncharacterized protein. C11orf96 has been identified as a host protein upregulated after viral infection .

  • Cloning and Sequencing The coding sequence (CDS) region of the C11orf96 gene has been cloned in cat, human, and mouse . The CDS region is 372 bp long, encoding 124 amino acids, and is relatively conserved across different mammals .

  • Bioinformatics Analysis Bioinformatics analysis indicates that C11orf96 is rich in Serine (Ser) and has multiple predicted phosphorylation sites . Protein interaction prediction analysis suggests that this protein is associated with several transmembrane family proteins and zinc finger proteins .

  • Tissue Distribution C11orf96 is primarily distributed in the cytoplasm and is found in all tissues and organs, with the highest expression levels in the kidney, suggesting a specific biological role in this organ .

Implications for Research

The study of uncharacterized proteins like C10orf111 and C11orf96 is essential for expanding our understanding of the human genome and cellular processes . These proteins may play critical roles in various biological functions, and their interactions with other proteins and complexes could provide insights into gene regulation, development, and disease .

Tables in Research

When presenting research findings, tables are essential for organizing complex data in a clear and accessible manner . Tables should be comprehensible, allowing readers to understand the results without reading the main text .

Table 1: Histopathological Diagnosis

Histopathological diagnosisMen n (%)Women n (%)Total n (%)
Adrenal cortical adenoma5 (31.3)6 (37.6)11 (68.8)
Pheochromocytoma1 (6.2)1 (6.2)2 (12.6)
Ganglioneuroma1 (6.2)-1 (6.2)
Myelolipoma-1 (6.2)1 (6.2)
Adrenal carcinoma-1 (6.2)1 (6.2)
Total7 (43.7)9 (56.2)16 (100)

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, we prioritize fulfilling requests for specified tags; please communicate your preferences accordingly.
Synonyms
RPP38-DT; C10orf111; Putative uncharacterized protein RPP38-DT; RPP38 divergent transcript protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
C10orf111
Target Protein Sequence
MESLQTPQHRENQDKREKEYGVKHMPMGNNAGNLEPEKRKAVRVALSSATAAQNIPSSVH CGCSKQWRLRLPSESLQSRGQVMKRPNNILKLRNLDLLIYPWPELRRRQVASDLMSLLLL PAFSGLTWAPFLFLFTYLPPFLNLLTVGFVSYFLV
Uniprot No.

Target Background

Database Links

HGNC: 28582

KEGG: hsa:221060

STRING: 9606.ENSP00000367449

UniGene: Hs.567777

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are optimal for producing Recombinant Human Uncharacterized protein C10orf111?

Expression SystemAdvantagesLimitationsRecommended for
E. coliHigh yield, rapid production, cost-effectiveLimited post-translational modificationsInitial characterization, structural studies
YeastGood yield, some eukaryotic modificationsNot all human-like modificationsFunctional screening, moderate-scale production
Insect cells (baculovirus)Better post-translational modificationsLonger production time, more expensiveProtein folding studies, activity assays
Mammalian cellsMost human-like modificationsLowest yield, highest costActivity retention, interaction studies

The choice depends on whether your priority is quantity (E. coli/yeast) or maintaining native protein characteristics through proper post-translational modifications (insect/mammalian cells) . For uncharacterized proteins like C10orf111, it's often advisable to test multiple systems to determine which best preserves the protein's biological activity.

What are the key considerations for designing experiments to characterize C10orf111?

When designing experiments to characterize C10orf111, researchers should implement a systematic approach that addresses the protein's unknown functions. A well-structured experimental design requires:

  • Clear definition of variables: Identify independent variables (e.g., expression conditions, binding partners) and dependent variables (e.g., protein activity, cellular localization) .

  • Testable hypotheses: Formulate specific hypotheses about the protein's function based on bioinformatic analysis, such as sequence homology with characterized proteins .

  • Comprehensive controls: Include positive controls (known related proteins), negative controls, and empty vector controls to validate experimental outcomes .

  • Multiple methodological approaches: Combine techniques such as:

    • Subcellular localization studies

    • Interaction partner identification (co-immunoprecipitation, yeast two-hybrid)

    • Expression pattern analysis across tissues

    • Loss-of-function and gain-of-function experiments

The experimental design should include careful planning to control extraneous variables that might influence your results, ensuring that any observed effects can be attributed to C10orf111 with confidence .

How can bioinformatic approaches assist in predicting potential functions of C10orf111?

Bioinformatic approaches provide essential foundational information for uncharacterized proteins like C10orf111. These computational methods can guide experimental design by generating testable hypotheses about protein function:

  • Sequence-based analysis:

    • Homology searches across species to identify evolutionary conservation

    • Domain identification to predict functional regions

    • Secondary structure predictions to inform structural studies

  • Structural prediction tools:

    • Ab initio modeling for tertiary structure prediction

    • Comparison with structural databases to identify potential functional similarities

  • Genomic context analysis:

    • Co-expression networks to identify functionally related genes

    • Chromosomal proximity analysis to identify potential operons or gene clusters

  • Systems biology approaches:

    • Pathway integration analysis to predict involvement in known biological processes

    • Protein-protein interaction network predictions

Recent approaches used in characterizing other previously uncharacterized proteins, such as C9orf85 and CXorf38, revealed relationships with essential micronutrients like manganese and selenium . Similar approaches could be applied to C10orf111 to generate initial functional hypotheses.

What strategies can be employed to determine if C10orf111 has tissue-specific expression or function?

Determining tissue-specific expression and function of C10orf111 requires multiple complementary approaches:

  • Transcriptome analysis:

    • RNA-seq data from various human tissues can reveal tissue-specific expression patterns

    • Single-cell RNA-seq can provide cellular resolution of expression

    • Comparison of expression levels under various physiological conditions

  • Protein detection methodologies:

    • Development of specific antibodies against C10orf111

    • Immunohistochemistry and immunofluorescence on tissue arrays

    • Western blotting of tissue lysates with quantitative analysis

  • Functional screening in tissue contexts:

    • CRISPR-Cas9 knockout in tissue-specific cell lines

    • Phenotypic assays tailored to tissue-specific functions

    • Rescue experiments with wild-type protein

  • Conditional expression systems:

    • Tissue-specific promoters to drive expression in select tissues

    • Inducible expression systems to control timing of expression

This multi-method approach allows researchers to triangulate both where C10orf111 is expressed and where its function is physiologically relevant. Similar approaches have been successfully applied to other uncharacterized proteins, revealing their specific roles in various tissues and disease states .

What experimental approaches are most effective for identifying potential binding partners or substrates of C10orf111?

Identifying interaction partners is crucial for understanding the functional role of uncharacterized proteins like C10orf111. The following complementary approaches provide a comprehensive strategy:

ApproachMethodologyAdvantagesLimitationsData Analysis Consideration
Affinity Purification-Mass SpectrometryTagged C10orf111 is expressed, purified with interacting proteins, and identified by MSIdentifies multiple interactions simultaneouslyMay detect non-physiological interactionsRequires rigorous statistical filtering and validation
Yeast Two-HybridC10orf111 is used as bait to screen libraries of potential interactorsLarge-scale screening capabilityHigh false positive rateMultiple retesting required
Proximity LabelingBioID or APEX2 fusion proteins label nearby proteins in living cellsCaptures transient interactions in native environmentRequires genetic manipulationControl experiments critical for specificity
Co-immunoprecipitationAntibodies against C10orf111 pull down protein complexesDetects native complexesRequires high-quality antibodiesWestern blot validation necessary
Crosslinking Mass SpectrometryChemical crosslinking stabilizes interactions before analysisCaptures weak/transient interactionsComplex data analysisSpecialized bioinformatics required

For each identified interaction, validation through orthogonal methods is essential. The combination of these techniques has proven effective in characterizing interaction networks for previously uncharacterized proteins, such as those described in the Research Topic "Characterizing the uncharacterized human proteins" .

How can researchers address the challenge of potential post-translational modifications in C10orf111?

Post-translational modifications (PTMs) can significantly impact protein function, particularly for uncharacterized proteins where the role of modifications remains unknown. A systematic approach to investigating PTMs in C10orf111 includes:

  • Predictive analysis:

    • Computational prediction of potential modification sites (phosphorylation, glycosylation, etc.)

    • Structural modeling to assess accessibility of predicted sites

  • Expression system selection:

    • Mammalian and insect cell systems provide many of the post-translational modifications necessary for correct protein folding and activity retention

    • Comparison of protein produced in different systems to identify modification-dependent properties

  • Direct PTM detection:

    • Mass spectrometry approaches:

      • Enrichment strategies for specific modifications

      • Top-down proteomics for intact protein analysis

      • Bottom-up approaches for site-specific identification

    • PTM-specific antibodies when available

  • Functional significance assessment:

    • Site-directed mutagenesis of predicted modification sites

    • Comparison of wildtype and mutant protein activities

    • Treatment with demodifying enzymes (phosphatases, deglycosylases)

Research on uncharacterized proteins has demonstrated that PTMs often play crucial roles in protein function, localization, and stability . For C10orf111, expression in mammalian cells would be particularly relevant if PTM-dependent activity is suspected, despite the lower yield compared to prokaryotic systems .

What considerations should guide the development of assays to detect potential enzymatic activity of C10orf111?

Developing functional assays for an uncharacterized protein like C10orf111 requires systematic hypothesis testing based on structural and sequence features:

  • Initial activity hypothesis generation:

    • Sequence analysis for catalytic motifs

    • Structural homology to known enzymes

    • Phylogenetic analysis for functional conservation

    • Metabolite profiling in cells overexpressing C10orf111

  • Substrate screening approaches:

    • Panel testing of common substrates for major enzyme classes

    • Activity-based protein profiling

    • Metabolomics comparison between wildtype and C10orf111-expressing cells

  • Assay development considerations:

    • Buffer optimization (pH, ionic strength, cofactors)

    • Detection method selection (fluorescence, absorbance, coupled assays)

    • Kinetic vs. endpoint measurements

    • Reaction conditions optimization (temperature, time)

  • Validation strategies:

    • Site-directed mutagenesis of predicted catalytic residues

    • Inhibitor screening and specificity testing

    • Isothermal titration calorimetry for binding studies

Similar approaches have been successfully implemented for other previously uncharacterized proteins, revealing unexpected enzymatic activities and substrate specificities . The experimental design should include appropriate controls and statistical analysis to ensure reliable detection of enzymatic activity .

How should researchers interpret contradictory data when characterizing C10orf111?

When characterizing uncharacterized proteins like C10orf111, researchers often encounter seemingly contradictory results. A methodical approach to resolving these contradictions includes:

  • Systematic hypothesis re-evaluation:

    • Reassess initial assumptions about protein function

    • Consider context-dependent activities (tissue-specific, condition-dependent)

    • Evaluate whether the protein has multiple distinct functions

  • Methodological evaluation:

    • Assess specificity and sensitivity of different experimental approaches

    • Consider whether tag placement or expression system affects protein function

    • Evaluate whether cell line or organism models are appropriate

  • Reconciliation strategies:

    • Design experiments that directly test competing hypotheses

    • Develop more sensitive or specific assays

    • Use orthogonal approaches to validate findings

  • Data integration framework:

    • Develop a comprehensive model that accounts for all observations

    • Weight evidence based on methodological strength

    • Consider evolutionary context for functional predictions

When addressing contradictory findings, researchers should implement careful experimental design principles, including appropriate controls and statistical analysis, to determine whether contradictions represent genuine biological complexity or methodological limitations .

What are best practices for validating initial findings about C10orf111 function?

Robust validation of initial findings is critical when working with uncharacterized proteins like C10orf111:

  • Independent experimental replication:

    • Replicate findings using different experimental approaches

    • Test in multiple cell lines or model systems

    • Have independent researchers reproduce key findings

  • Orthogonal validation methods:

    • If protein-protein interaction is discovered, validate by co-immunoprecipitation, FRET, and functional assays

    • If cellular localization is determined, confirm with fractionation, immunostaining, and live-cell imaging

    • If enzymatic activity is identified, confirm with multiple substrate assays and inhibitor studies

  • Genetic manipulation strategies:

    • CRISPR-Cas9 knockout to confirm loss-of-function phenotypes

    • Rescue experiments with wild-type and mutant constructs

    • siRNA/shRNA for transient knockdown validation

  • Translational relevance assessment:

    • Examine human genetic data for associations with disease

    • Analyze patient samples for altered expression or function

    • Develop animal models to validate physiological significance

How does the approach to studying C10orf111 compare with other successfully characterized "orphan" proteins?

The characterization of uncharacterized or "orphan" proteins has yielded valuable lessons that can be applied to C10orf111 research:

  • Comparative methodological analysis:

    • Success stories from other characterized proteins, such as C9orf85 and CXorf38, highlight the importance of investigating relationships with essential micronutrients

    • The characterization of Mxi1-0 demonstrated the value of examining isoform-specific functions in different physiological contexts

    • ARRDC2 characterization revealed the importance of expression level analysis in disease contexts

  • Integrated multi-omics approach:

    • Successful characterization often combines genomics, transcriptomics, proteomics, and metabolomics

    • Translatome sequencing has proven valuable for identifying novel protein isoforms, as demonstrated in hepatocellular carcinoma research

  • Evolutionary conservation analysis:

    • Comparing functional domains across species has provided insights into conserved functions

    • Analysis of selection pressure on protein regions can highlight functionally important domains

  • Disease association strategies:

    • Examining rare variants in human populations has revealed functional insights, as seen with ARHGAP31 and FBLN1 variants

    • Cancer research contexts have proven valuable for characterizing proteins like ARRDC2 in ovarian cancer

Adopting these proven strategies while maintaining rigorous experimental design principles provides a roadmap for successfully characterizing C10orf111.

What considerations should guide researchers in selecting appropriate control proteins for C10orf111 studies?

Selecting appropriate controls is crucial for generating reliable data when studying uncharacterized proteins like C10orf111:

  • Positive control selection criteria:

    • Proteins with similar domain architecture

    • Proteins from the same chromosomal region (other C10orf proteins)

    • Proteins with similar predicted structure

    • Well-characterized proteins with expected similar localization

  • Negative control considerations:

    • Proteins with confirmed different localization or function

    • Closely related proteins with known distinct functions

    • Empty vector or untransfected controls for expression studies

  • Technical control selection:

    • Tagged versions of well-characterized proteins to control for tag effects

    • Housekeeping proteins for normalization in expression studies

    • Scrambled siRNA sequences for knockdown studies

  • Context-specific controls:

    • Tissue-specific expression controls when analyzing tissue distribution

    • Cell cycle-specific controls if cell cycle dependence is suspected

    • Stress response controls if function may be stress-related

When selecting controls, researchers should consider experimental design principles to ensure that the controls adequately account for potential confounding variables . The selection of appropriate controls has been demonstrated as critical in the successful characterization of other previously uncharacterized proteins .

What emerging technologies might accelerate the functional characterization of C10orf111?

Several cutting-edge technologies show particular promise for accelerating the characterization of uncharacterized proteins like C10orf111:

  • AlphaFold2 and structural prediction tools:

    • Highly accurate structural predictions can suggest functional domains

    • Structure-based function prediction algorithms can propose potential activities

    • Virtual screening against predicted structures can identify potential ligands

  • CRISPR-based functional genomics:

    • Genome-wide CRISPR screens can identify synthetic lethal interactions

    • CRISPRi/CRISPRa for gene expression modulation without protein modification

    • Base editing for introducing specific amino acid changes without double-strand breaks

  • Single-cell multi-omics:

    • Single-cell proteomics to identify cell-specific expression patterns

    • Spatial transcriptomics to map expression in tissue contexts

    • Integrated single-cell data analysis to identify co-regulated networks

  • Advanced mass spectrometry techniques:

    • Hydrogen-deuterium exchange mass spectrometry for structural dynamics

    • Crosslinking mass spectrometry for interaction mapping

    • Top-down proteomics for intact protein analysis with PTMs

These technologies, when applied with careful experimental design , offer unprecedented opportunities to rapidly advance our understanding of C10orf111 function, similar to recent advances in characterizing other previously unstudied proteins .

How might researchers develop a systematic roadmap for complete characterization of C10orf111?

A comprehensive roadmap for characterizing C10orf111 should follow a logical progression from basic to advanced studies:

  • Phase I: Foundational Characterization (6-12 months)

    • Bioinformatic analysis and hypothesis generation

    • Expression optimization in multiple systems

    • Subcellular localization determination

    • Basic expression pattern analysis across tissues and conditions

  • Phase II: Functional Investigation (12-24 months)

    • Protein interaction partner identification

    • Post-translational modification mapping

    • Loss-of-function and gain-of-function phenotypic studies

    • Initial enzymatic activity screening

  • Phase III: Mechanistic Studies (18-36 months)

    • Detailed biochemical characterization

    • Structure determination (X-ray crystallography, Cryo-EM)

    • Mutational analysis of key residues

    • Development of specific inhibitors or activators

  • Phase IV: Physiological and Pathological Relevance (24-48 months)

    • Animal model development and characterization

    • Disease association studies

    • Therapeutic targeting potential assessment

    • Integration into known biological pathways

This systematic approach mirrors successful characterization strategies applied to other previously uncharacterized proteins while adhering to rigorous experimental design principles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.