Recombinant Human Uncharacterized protein C10orf35 (C10orf35)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requirements should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag is required, please specify this during your order, and we will prioritize its inclusion.
Synonyms
FAM241B; C10orf35; Protein FAM241B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAM241B
Target Protein Sequence
MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAA QSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQ R
Uniprot No.

Target Background

Function
Plays a potential role in lysosome homeostasis.
Database Links

HGNC: 23519

KEGG: hsa:219738

STRING: 9606.ENSP00000362376

UniGene: Hs.522992

Protein Families
FAM241 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is C10orf35 and what are its alternative names?

C10orf35 is an uncharacterized human protein encoded by a gene located on chromosome 10 (Chromosome 10 Open Reading Frame 35). According to current nomenclature, C10orf35 is also known as FAM241B (Family With Sequence Similarity 241 Member B) and is referenced as Protein FAM241B in some databases . The protein has UniProt ID Q96D05 and remains largely uncharacterized in terms of its complete biological function, though recent research has begun to implicate it in lysosomal function .

What is the subcellular localization of C10orf35?

Based on experimental evidence, C10orf35 appears to be associated with the endolysosomal pathway. Knockout of C10orf35 leads to the formation of enlarged vesicles derived from the endolysosomal pathway, as confirmed by LAMP2 immunostaining . This suggests that C10orf35 is likely localized to endosomes and/or lysosomes, where it plays a role in maintaining the structural and functional integrity of these organelles. The protein's sequence contains hydrophobic regions consistent with membrane association, further supporting its localization to membrane-bound organelles like lysosomes.

What purification strategies are effective for recombinant C10orf35?

Affinity chromatography using the His tag is an effective purification strategy for recombinant C10orf35. The N-terminal His tag allows for purification using nickel or cobalt affinity resins. According to published data, purified recombinant C10orf35 protein shows greater than 90% purity as determined by SDS-PAGE , indicating that affinity chromatography is sufficient to obtain highly pure protein. The purified protein is typically provided as a lyophilized powder in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How can researchers validate successful expression of recombinant C10orf35?

Several methods can be used to validate the successful expression of recombinant C10orf35:

  • SDS-PAGE to visualize the protein band at the expected molecular weight

  • Western blotting using antibodies against C10orf35 or the His tag to confirm protein identity

  • Mass spectrometry for definitive identification and sequence confirmation

  • Functional assays to test whether the recombinant protein can rescue phenotypes observed in C10orf35 knockout cells

How can CRISPR/Cas9 be used to study C10orf35 function?

CRISPR/Cas9 technology has been successfully used to create C10orf35 knockout cell lines for functional studies. The approach involves:

  • Designing sgRNAs targeting C10orf35 (multiple sgRNA sequences can be used to ensure effective targeting)

  • Creating knockout clones after transfection with CRISPR/Cas9 components

  • Validating knockouts by sequencing to confirm frame-shifting indel mutations that result in premature truncation of the targeted gene

  • Assessing the effect of C10orf35 knockout on cellular phenotypes, including formation of vacuolated cells and increased LysoSensor staining

  • Verifying complete absence of targeted protein expression via Western blotting

This approach has revealed that C10orf35 knockout results in the formation of enlarged vesicles derived from the endolysosomal pathway, suggesting a role for C10orf35 in lysosomal function .

What is the role of C10orf35 in lysosomal function?

Recent research using CRISPR knockout screens has implicated C10orf35 in lysosomal function. The specific mechanism by which C10orf35 contributes to lysosomal function is not fully elucidated, but knockout of C10orf35 results in the formation of enlarged vesicles derived from the endolysosomal pathway . This phenotype is similar to that observed in cells lacking FIG4 or VAC14, which are known regulators of phosphoinositide metabolism and lysosomal function. This suggests that C10orf35 may be involved in the maintenance of lysosomal structure and function, possibly through regulation of membrane trafficking, fusion, or fission processes.

How does C10orf35 knockout affect cellular phenotype?

C10orf35 knockout results in a distinct cellular phenotype characterized by:

  • Formation of vacuolated cells visible by phase contrast microscopy

  • Significantly greater LysoSensor staining compared to wild-type cells, indicating altered lysosomal pH or function

  • Enlarged vesicles derived from the endolysosomal pathway, as confirmed by LAMP2 immunostaining

The degree of vacuolation in C10orf35 knockout cells is less pronounced compared to FIG4 or VAC14 knockouts, suggesting "non-identical roles for these factors, or differential sensitivity to their loss" . This indicates that while C10orf35 is involved in lysosomal function, its role may be distinct from or complementary to that of other lysosomal regulators.

What diseases are associated with C10orf35 mutations?

Based on the functional link between C10orf35 and lysosomal function, it has been suggested that "disruptive variants in C10orf35 found by clinical sequencing should be considered candidate genes for neuromuscular and lysosomal disorders of unknown origin" . Lysosomal disorders often present with neurological and/or muscular symptoms due to the accumulation of unprocessed substrates in lysosomes. While specific disease associations have not been definitively established for C10orf35 mutations, the vacuolation phenotype observed in C10orf35 knockout cells suggests that loss-of-function mutations in this gene could contribute to lysosomal storage disorders or other conditions characterized by lysosomal dysfunction.

How can C10orf35 be used in studies of lysosomal storage disorders?

Given its role in lysosomal function, C10orf35 can serve as a valuable tool for studying lysosomal storage disorders (LSDs) in several ways:

  • As a candidate gene for undiagnosed LSDs: Mutations in C10orf35 should be considered in patients with neuromuscular and lysosomal disorders of unknown origin

  • As a model system: C10orf35 knockout cells exhibit a vacuolation phenotype that may mimic aspects of LSDs, providing a cellular model for studying disease mechanisms

  • For drug screening: The vacuolization phenotype in C10orf35 knockout cells could be adapted for drug screening to identify therapeutic small molecules that reverse this phenotype

  • For mechanistic studies: Understanding how C10orf35 contributes to lysosomal function may provide insights into the fundamental mechanisms underlying lysosomal homeostasis

What experimental designs are most effective for elucidating C10orf35 function?

Based on general principles of experimental design and current C10orf35 research, effective approaches include:

  • Genetic manipulation: Creating knockout, knockdown, or overexpression models of C10orf35 to observe resulting phenotypes

  • Structure-function analysis: Generating truncated or mutated versions of C10orf35 to identify functional domains or residues

  • Rescue experiments: Reintroducing wild-type or modified C10orf35 into knockout cells to determine necessary domains

  • Localization studies: Using fluorescently tagged C10orf35 or immunofluorescence to determine its subcellular localization

  • Functional assays: Measuring lysosomal pH, enzyme activity, or membrane dynamics in cells with altered C10orf35 expression

  • Comparative studies: Comparing the effects of C10orf35 manipulation with those of known lysosomal regulators like FIG4 or VAC14

A comprehensive experimental approach would combine multiple of these methods to build a thorough understanding of C10orf35 function.

How should researchers address contradictory findings related to C10orf35 function?

When faced with contradictory findings regarding C10orf35 function, researchers should:

  • Analyze contextual differences: Different experimental conditions, cell types, or organism models may explain contradictions

  • Check for underspecified context: Conflicts may be due to differences in species, temporal context, or environmental phenomena

  • Consider methodological differences: Variations in experimental design, reagents, or analytical approaches can lead to apparently contradictory results

  • Validate key findings: Independently validate contradictory findings using multiple methods

  • Reconcile apparent contradictions: Develop hypotheses that could explain seemingly contradictory results

The analysis of contradictions in biomedical literature highlights that apparent contradictions are often due to "underspecified context, including differences in species, temporal context, and environmental phenomena" , which underscores the importance of detailed contextual information when reporting research findings.

What controls should be included when studying C10orf35?

When studying C10orf35, several controls should be included to ensure robust and interpretable results:

  • Positive controls: Include known regulators of lysosomal function, such as VAC14, as positive controls for phenotypic assays

  • Negative controls: Use scrambled or non-targeting siRNAs/sgRNAs in knockdown or knockout experiments

  • Rescue controls: Reintroduce wild-type C10orf35 into knockout cells to confirm that observed phenotypes are specifically due to loss of C10orf35

  • Expression controls: Verify protein expression levels by Western blotting

  • Specificity controls: For antibody-based assays, include control experiments without primary antibody or with blocking peptides, such as the C10orf35 control fragment

  • Technical and biological replicates: Perform multiple technical and biological replicates to assess experimental variability and ensure reproducibility

How can researchers distinguish direct vs. indirect effects of C10orf35 manipulation?

Distinguishing direct from indirect effects of C10orf35 manipulation requires a combination of approaches:

  • Temporal analysis: Monitor changes over time following C10orf35 manipulation to identify early (likely direct) versus late (potentially indirect) effects

  • Dose-response relationships: Vary the level of C10orf35 expression or inhibition to identify dose-dependent effects

  • Protein-protein interaction studies: Identify direct binding partners of C10orf35 using techniques such as co-immunoprecipitation or proximity labeling

  • Acute vs. chronic manipulation: Compare acute versus chronic loss of C10orf35 to differentiate between immediate and adaptive responses

  • Structure-function analysis: Create mutants that disrupt specific interactions or functions to determine which aspects of C10orf35 are required for different phenotypes

By systematically applying these approaches, researchers can build a more nuanced understanding of how C10orf35 contributes to lysosomal function and distinguish its direct molecular activities from downstream effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.