Recombinant Human Uncharacterized protein C12orf28 (C12orf28)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during the production process. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
MYRFL; C12orf15; C12orf28; Myelin regulatory factor-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-275
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
MYRFL
Target Protein Sequence
DRRVPNLPPSNITSSQEPALLPTASSSAPNTSLVTTPASLQVPEITFCEILPCQETYCCP IRGMKEVSSSPVQRQSEEKEFHQRRWSEDKSKSVLARNALSGPDWESDWIDTTISSIQIM EIQQIIDHQYCIQSLQCGSGNYNYNIPVNKHTPTNVKFSLEINTTEPLIVFQCKFTLGNI CFHSKRGTKGMESHREISQEMTQGYQHIWSLPVAPFSDSMFHFRVAAPDLADCSTDPYFA GIFFTDYFFYFYRRCA
Uniprot No.

Target Background

Database Links

HGNC: 26316

KEGG: hsa:196446

STRING: 9606.ENSP00000449598

UniGene: Hs.253773

Protein Families
MRF family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the optimal expression system for recombinant production of uncharacterized protein C12orf28?

The optimal expression system for C12orf28 production typically involves bacterial expression using E. coli cells with induction via IPTG at lower temperatures (16°C) for extended periods (12 hours). This approach helps maintain protein solubility and proper folding. For purification, a dual-tagging system with His-tags combined with SUMO fusion at the N-terminus offers superior results for maintaining protein stability and functionality. The protein can be harvested and lysed in mild neutral buffer (20 mM Tris pH 7.5, 200 mM NaCl, 1 mM PMSF) followed by Ni-NTA agarose bead purification and size-exclusion chromatography to remove degradation products .

How can I verify the purity and identity of recombinantly expressed C12orf28?

Verification of recombinant C12orf28 requires multiple analytical approaches. After purification using the optimized methodology described above, aim for >95% purity as assessed by SDS-PAGE. Identity confirmation should involve Western blotting with commercially available antibodies specific to the protein or its tags. Mass spectrometry analysis provides definitive confirmation of molecular weight and sequence coverage. For functional verification, employ biophysical techniques such as circular dichroism to assess proper protein folding. Additionally, testing reactivity with commercial antibodies against similar proteins can provide comparative identification metrics .

What control experiments should be included when studying C12orf28 binding interactions?

When studying binding interactions of C12orf28, several control experiments are essential:

  • Use defined substrates like reconstituted nucleosome core particles (NCPs) with strong positioning DNA sequences

  • Include unrelated proteins of similar size/charge as negative controls

  • Utilize known binding partners of related proteins as positive controls

  • Perform competition assays with unlabeled protein to verify specificity

  • Include buffer-only controls to account for non-specific binding

Quantitative assessment through Biolayer Interferometry (BLI) provides reliable kinetic parameters (kon and koff) to characterize binding interactions. This method allows for the uncoupling of variant-specific regulation and compaction functions, enabling testing of binding properties independent of other modifications .

How stable is C12orf28 under various experimental conditions?

The stability profile of recombinant C12orf28 should be systematically evaluated across multiple parameters:

ParameterOptimal RangeDestabilization PointMethod of Assessment
pH7.0-7.5<6.0 or >8.5Circular dichroism
Temperature4-25°C>37°CDifferential scanning fluorimetry
Salt concentration150-300 mM NaCl<50 mM or >500 mMSize exclusion chromatography
Reducing agents1-5 mM DTT/β-ME>10 mMFluorescence spectroscopy
Storage durationUp to 1 week at 4°C>2 weeksActivity assays

For optimal stability maintenance, recombinant C12orf28 should be stored with 10% glycerol at -80°C for long-term preservation. Before experimental use, thaw samples on ice and centrifuge to remove any aggregates .

What are the recommended buffer conditions for functional studies of C12orf28?

For functional characterization of C12orf28, buffer optimization is crucial. The recommended starting buffer consists of 20 mM Tris (pH 7.5), 200 mM NaCl, 1 mM DTT, and 5% glycerol. Depending on the specific assay, consider supplementation with:

  • 1-2 mM MgCl₂ for potential enzymatic activity

  • 0.05% NP-40 or 0.01% Triton X-100 to reduce non-specific interactions

  • 0.1 mg/ml BSA as a stabilizing agent for dilute protein solutions

When conducting binding assays, maintain consistent buffer conditions between the protein preparation and the experimental setup to avoid artifacts from buffer mismatch. For chromatin interaction studies, include 0.1-0.5 mg/ml of fragmented salmon sperm DNA to reduce non-specific DNA binding .

How do 3D conformation and stability measurements inform C12orf28 function prediction?

3D conformational stability of C12orf28 can be assessed using a block copolymer model composed of a series of alternating structural elements. Experimental approaches to measuring 3D chromatin interaction stability provide insights into potential chromatin-binding functions of C12orf28. If the protein contains motifs similar to CTCF or cohesin complex proteins, it may participate in chromatin loop formation or maintenance .

Analysis of C12orf28 stability within chromatin neighborhoods could reveal its role in gene regulation. In particular, auxin-inducible degron systems can be employed to investigate how degradation of C12orf28 affects chromatin architecture, similar to techniques used for studying CTCF/cohesin complexes. If C12orf28 degradation alters gene expression patterns (either upregulation or downregulation), this would suggest a regulatory role, potentially through chromatin loop formation or insulator function .

What experimental designs are most appropriate for determining C12orf28 function in cellular contexts?

Given the uncharacterized nature of C12orf28, multiple experimental design approaches should be employed:

  • True Experimental Designs: Utilize pretest-posttest control group designs with random assignment where C12orf28 expression is manipulated as the independent variable. This approach controls for history, maturation, and testing effects while enabling causal inferences about C12orf28 function .

  • Solomon Four-Group Design: This robust approach combines the pretest-posttest control group design with posttest-only controls, allowing researchers to assess interaction effects between testing and experimental treatments when investigating C12orf28 .

  • Quasi-Experimental Approaches: When complete randomization is impossible (such as with specific cell lines or primary tissues), time-series designs can reveal patterns of cellular response to C12orf28 manipulation across multiple measurement points .

For cellular context studies, CRISPR-Cas9 knockout/knockin systems provide precise genetic manipulation capabilities. Inducible expression systems allow temporal control over C12orf28 expression, facilitating the study of acute versus chronic effects on cellular phenotypes.

How can I resolve contradictory findings in C12orf28 localization studies?

Contradictory findings in C12orf28 localization require systematic troubleshooting:

  • Antibody Validation: Test multiple antibodies against different epitopes of C12orf28. Verify specificity through knockout controls and peptide competition assays.

  • Cell Type-Specific Effects: Evaluate localization across multiple cell types to determine if contradictions arise from tissue-specific factors.

  • Fixation Artifacts: Compare different fixation methods (paraformaldehyde, methanol, glutaraldehyde) as certain proteins show fixation-dependent localization patterns.

  • Expression Level Issues: Compare endogenous versus overexpressed protein, as excessive expression can produce misleading localization patterns.

  • Conditional Localization: Investigate whether cellular stress, cell cycle stage, or post-translational modifications affect localization.

Resolution of contradictory findings frequently requires triangulation of methods: combining immunofluorescence, subcellular fractionation, and live cell imaging with fluorescent protein fusions to establish consensus on authentic localization patterns .

What bioinformatic approaches can predict potential interaction partners for C12orf28?

Predictive bioinformatic analysis for C12orf28 interaction partners should employ a multi-layered approach:

Analytical MethodData InputPrediction OutputValidation Approach
Domain-based interaction predictionC12orf28 sequenceProteins with complementary binding domainsCo-immunoprecipitation
Structural homology modelingRelated protein structures3D interaction interfacesMutagenesis of predicted interface residues
Co-expression network analysisTranscriptomic datasetsGenes with correlated expression patternssiRNA knockdown followed by expression analysis
Evolutionary conservationOrtholog alignmentConserved functional residuesDirected evolution assays
Text mining and literature analysisPublished research dataPreviously identified interactors of related proteinsProtein array screening

For uncharacterized proteins like C12orf28, integration of these approaches through machine learning algorithms can significantly improve prediction accuracy. Experimental validation should prioritize the highest-confidence predictions using proximity labeling techniques like BioID or APEX to identify proximal proteins in living cells .

How do post-translational modifications affect C12orf28 function and stability?

Post-translational modifications (PTMs) can significantly impact C12orf28 function through multiple mechanisms:

  • Phosphorylation sites: Analyze C12orf28 for potential phosphorylation motifs using prediction tools like NetPhos. Map these sites through mass spectrometry before and after cellular signaling stimulation.

  • Ubiquitination: Investigate proteasomal degradation pathways that may regulate C12orf28 stability. Proteasome inhibitors (MG132) can be used to determine if C12orf28 undergoes regulated degradation.

  • SUMOylation: This modification often affects protein localization and function in chromatin-associated proteins. Analyze C12orf28 for consensus SUMOylation sites and test the effects of SUMO-protease inhibitors on protein function.

  • Glycosylation: If C12orf28 is secreted or membrane-associated, N-linked or O-linked glycosylation may affect stability and interaction properties.

For each identified PTM, site-directed mutagenesis should be employed to create modified-mimetic and modification-resistant variants. Compare these variants through functional assays to determine the biological significance of each modification site .

What purification protocol is recommended for obtaining high-yield, functional C12orf28?

For optimal purification of C12orf28, implement the following robust protocol:

  • Expression System: Utilize E. coli cells grown to OD600 of 0.6, followed by IPTG induction at 16°C for 12 hours.

  • Cell Lysis: Harvest and lyse cells in a mild neutral buffer (20 mM Tris pH 7.5, 200 mM NaCl, 1 mM PMSF).

  • Initial Purification: Incubate the cleared lysate containing doubly His-tagged protein with Ni-NTA agarose beads for 1 hour at 4°C.

  • Size Exclusion: Load eluted protein on a preparative scale S200 10/300 size-exclusion column to remove degradation and early termination products.

  • Tag Removal: Pool full-length H1-enriched fractions and treat with Ulp-1 for 1 hour at room temperature to cleave the N-terminal SUMO tag.

  • C-terminal Processing: Follow with 6-hour treatment at room temperature with 500 mM β-ME to promote auto-excision of the GyrA intein, leaving a free acid C-terminus.

This protocol consistently yields >95% pure protein with an average yield of 1 mg at 10 μM concentration. Verify purity through SDS-PAGE and confirm identity using commercial antibodies specific to the target protein .

How should researchers design binding assays to study C12orf28 interactions with chromatin?

For studying C12orf28 interactions with chromatin, implement the following methodological approach:

  • Substrate Preparation: Assemble octamers using recombinantly purified core histones and reconstitute nucleosome core particles (NCPs) with the "601" strong nucleosome positioning DNA sequence.

  • Enhance Binding Surface: Add a 30 bp linker at the 3' end of the 601 sequence to create a docking surface similar to what has been used for H1 protein studies.

  • Quantitative Analysis: Employ Biolayer Interferometry (BLI) for quantitative measurement of kon and koff rates to characterize binding kinetics.

  • Control Experiments: Include non-specific protein controls and buffer-only samples to establish baseline signals and specificity.

  • Competitive Binding: Perform competition assays with unlabeled protein to verify binding site specificity.

This methodology enables examination of C12orf28 binding independent of variant-specific regulation, using defined substrates that eliminate variables from histone or DNA modifications that could alter binding patterns .

What approaches are most effective for studying C12orf28 in the context of gene regulation?

To investigate C12orf28's potential role in gene regulation, implement these complementary approaches:

  • Loss-of-Function Studies:

    • CRISPR-Cas9 knockout of C12orf28

    • siRNA/shRNA knockdown for temporal control

    • Auxin-inducible degron system for rapid protein depletion

  • Genomic Localization:

    • ChIP-seq to map chromatin binding sites

    • CUT&RUN for higher resolution with less background

    • HiChIP to identify potential long-range chromatin interactions

  • Transcriptional Impact:

    • RNA-seq after C12orf28 depletion/overexpression

    • PRO-seq to measure nascent transcription changes

    • Single-cell RNA-seq to capture cell-specific effects

  • Functional Validation:

    • Luciferase reporter assays with predicted regulatory elements

    • CRISPR activation/inhibition at C12orf28 binding sites

    • Chromosome conformation capture (3C, 4C, Hi-C) to assess chromatin architecture changes

Analysis should focus on identifying differentially expressed genes after C12orf28 manipulation, with special attention to genes near C12orf28 binding sites. If C12orf28 functions like CTCF, depletion may result in both upregulation and downregulation of genes, depending on its role in forming insulated neighborhoods or maintaining chromatin architecture .

How can researchers effectively use People Also Ask data to enhance C12orf28 research?

People Also Ask (PAA) data from Google search results can inform research strategies for C12orf28 by revealing knowledge gaps and research priorities:

  • Identify Research Trends: PAAs appear in over 80% of English searches, generally within the first few results, providing insight into what aspects of C12orf28 other researchers are investigating .

  • Expand Research Questions: When clicking on a PAA question, Google cascades additional related questions, which can help researchers expand their investigation scope beyond initial hypotheses .

  • Understand Knowledge Gaps: By analyzing the questions people ask about C12orf28, researchers can identify areas where scientific understanding is lacking.

  • Content Development Strategy: For publishing research findings, addressing common PAA questions ensures research has maximum impact and fulfills existing knowledge needs .

  • Track Research Evolution: Checking PAA data periodically reveals how research questions about C12orf28 evolve, informing when content updates or new experiments might be needed .

This approach acknowledges that for complex research topics, users typically perform multiple searches to complete their information-gathering task, with PAA data providing valuable insight into the research community's collective inquiry patterns .

What experimental design best addresses potential confounding variables in C12orf28 function studies?

To address confounding variables in C12orf28 function studies, implement robust experimental designs with appropriate controls:

  • Pretest-Posttest Control Group Design: Randomly assign samples/cells to experimental and control groups with measurements before and after C12orf28 manipulation. This controls for history, maturation, and testing effects .

  • Solomon Four-Group Design: Expand the above design by adding groups that receive only pretest or only posttest measurements. This allows detection of any interaction effects between testing and the experimental manipulation of C12orf28 .

  • Multiple Time-Series Measurements: For cell culture experiments, collect data at multiple timepoints to distinguish immediate from delayed effects of C12orf28 manipulation .

  • Genetic Background Control: When using CRISPR-Cas9 for gene editing, create and test multiple independent clonal lines to control for off-target effects and clonal variation.

  • Rescue Experiments: After knocking out C12orf28, reintroduce wild-type or mutant versions to establish causality between specific protein domains and observed phenotypes.

These approaches help eliminate alternative explanations for observed effects, strengthening causal inferences about C12orf28 function in complex biological systems .

How should researchers analyze contradictory data regarding C12orf28 cellular function?

When confronted with contradictory findings regarding C12orf28 function, apply these analytical strategies:

This systematic approach acknowledges that contradictions often reveal complex biological mechanisms rather than experimental failures, and may uncover condition-specific functions of C12orf28 .

What statistical approaches are appropriate for analyzing C12orf28 chromatin interaction data?

Chromatin interaction data for C12orf28 requires specialized statistical analyses:

Data TypeStatistical ApproachAdvantagesLimitations
ChIP-seqMACS2 peak calling with IDRIdentifies reproducible binding sitesMay miss weak/transient interactions
HiChIP/Hi-CFitHiC2, HiCCUPSDetects significant chromatin loopsRequires high sequencing depth
RNA-seq after manipulationDESeq2, edgeRRobust normalization for gene expression changesMay not capture immediate effects
Cut&RunSEACR, MACS2Better signal-to-noise for factor footprintingNewer method with evolving best practices
4C-seq4Cker, FourCSeqFocused analysis of interactions with a viewpointLimited to interactions with one region

For most robust analysis:

  • Implement appropriate multiple testing correction (Benjamini-Hochberg FDR)

  • Define appropriate fold-change thresholds based on biological significance

  • Perform power analysis to ensure adequate sample size

  • Include spike-in controls for quantitative comparisons between conditions

  • Validate key findings using independent molecular techniques

For uncharacterized proteins like C12orf28, integrating multiple data types through network analysis can provide more robust functional insights than any single dataset .

How can researchers differentiate between direct and indirect effects of C12orf28 on gene expression?

Differentiating direct from indirect effects of C12orf28 on gene expression requires a multi-faceted experimental approach:

  • Temporal Resolution Studies: Implement time-course experiments following C12orf28 induction or depletion. Direct targets typically show more rapid expression changes (within hours) compared to indirect effects (often days).

  • Transcription Inhibition: Use actinomycin D to block new transcription after C12orf28 manipulation. Direct targets show immediate expression changes whereas indirect targets continue changing after transcription block.

  • Nascent RNA Analysis: Techniques like PRO-seq or NET-seq measure actively transcribing RNA, providing a more immediate readout of transcriptional changes than steady-state RNA-seq.

  • Genome-wide Binding Correlation: Overlay C12orf28 ChIP-seq data with expression changes. Direct targets typically show binding at regulatory regions coupled with expression changes.

  • Inducible Systems: Rapid protein degradation systems (auxin-inducible degron) or activation systems allow temporal control, helping distinguish immediate from delayed responses .

  • Cell-free Transcription Systems: Reconstituted in vitro transcription with purified components can definitively establish direct regulatory capabilities of C12orf28.

This combined approach acknowledges that C12orf28 may function like other chromatin regulators (such as CTCF) that can both activate and repress gene expression through different mechanisms .

What are the appropriate controls for assessing antibody specificity in C12orf28 studies?

Rigorous validation of antibody specificity for C12orf28 requires multiple control experiments:

  • Western Blot on Knockout/Knockdown Samples: The most definitive control is comparing wild-type with CRISPR knockout or siRNA knockdown samples. A specific antibody will show absence of signal in knockout samples.

  • Peptide Competition Assay: Pre-incubation of the antibody with excess immunizing peptide should abolish specific signal if the antibody is truly recognizing C12orf28.

  • Recombinant Protein Control: Compare commercial recombinant C12orf28 with your purified protein to verify equivalent recognition by antibodies, as demonstrated in validation studies for other proteins .

  • Multiple Antibodies Targeting Different Epitopes: Use of independent antibodies recognizing distinct regions of C12orf28 should yield consistent results if specific.

  • Cross-reactivity Assessment: Test the antibody against closely related proteins to ensure it doesn't recognize unintended targets.

  • Immunoprecipitation-Mass Spectrometry: Perform IP followed by MS to confirm the antibody is pulling down C12orf28 rather than cross-reactive proteins.

These validation steps are essential before conducting extensive experimental analyses, as antibody specificity issues can lead to misinterpretation of localization, interaction, and functional data .

How should researchers interpret changes in chromatin architecture following C12orf28 manipulation?

Interpreting chromatin architecture changes after C12orf28 manipulation requires careful analysis:

  • Distinguish Direct from Secondary Effects: Compare immediate chromatin changes (0-6 hours post-manipulation) with longer-term effects (24+ hours) to separate primary architectural roles from secondary consequences.

  • Context-Specific Analysis: If C12orf28 functions like CTCF or cohesin components, its depletion might disrupt loop structures visible in 3C-based conformational maps. Analyze whether such changes occur globally or at specific genomic loci .

  • Functional Correlation: Correlate architectural changes with gene expression data. If C12orf28 has a role similar to CTCF, its depletion might affect genes with promoters near protein binding sites, suggesting a regulatory role for C12orf28/chromatin loop formations .

  • Insulation Analysis: Assess whether C12orf28 depletion alters topologically associating domain (TAD) boundaries, which would suggest an insulator function.

  • Enhancer-Promoter Connectivity: Analyze whether C12orf28 manipulation disrupts specific enhancer-promoter contacts, potentially revealing a role in gene regulation through facilitating or preventing these interactions.

  • Gene Ontology Analysis: Evaluate whether genes affected by C12orf28-dependent architectural changes share functional pathways, suggesting biological roles for the observed structural alterations.

This systematic approach recognizes that chromatin architectural proteins often have context-dependent functions that can be either activating or repressive depending on genomic location and cellular context .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.