Recombinant Human Transmembrane protein 52B (TMEM52B)

Shipped with Ice Packs
In Stock

Product Specs

Buffer
Lyophilized from a Tris/PBS-based buffer containing 6% trehalose, pH 8.0.
Form
Available as liquid or lyophilized powder. Note: We will ship the format currently in stock. If you require a specific format, please specify this in your order.
Lead Time
Orders typically ship within 1-3 business days. Delivery times may vary depending on shipping method and location. Please contact your local distributor for specific delivery timelines. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional charge.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tag.
Synonyms
TMEM52B; C12orf59; UNQ5927/PRO19821; Transmembrane protein 52B
Datasheet & Coa
Please contact us to get it.
Expression Region
25-183
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM52B
Target Protein Sequence
EENCGNPEHCLTTDWVHLWYIWLLVVIGALLLLCGLTSLCFRCCCLSRQQNGEDGGPPPC EVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHSHSSLGQLPSSLDTLPGYEEALHM SRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Gene References Into Functions
Studies indicate that C12orf59 exhibits broad expression across normal human tissues, with high expression in the kidney. Its expression is undetectable in a panel of cancer cell lines. (PMID: 26758419)
Database Links

HGNC: 26438

KEGG: hsa:120939

STRING: 9606.ENSP00000298530

UniGene: Hs.226422

Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is TMEM52B and what are its known isoforms?

Transmembrane protein 52B (TMEM52B, also known as C12orf59) is a novel gene first cloned in 2002 that is broadly expressed in various normal human tissues. TMEM52B has two main isoforms:

  • Isoform 1 (NM_153022): A 2789 bp mRNA that encodes a 163 amino acid protein

  • Isoform 2 (NM_001079815): A 2563 bp mRNA that differs in the 5' UTR and contains an alternate exon in the 5' coding region, encoding a 183 amino acid protein

Both isoforms are predicted to encode transmembrane proteins, but they differ in their N-terminal regions and subcellular localization. Recent studies have revealed these isoforms may have distinct functional roles in cancer progression, with TMEM52B-P18 and TMEM52B-P20 showing different capabilities in promoting cancer metastasis .

How is TMEM52B expressed in normal tissues versus cancer cells?

TMEM52B expression patterns show significant variation between normal tissues and cancer:

  • Normal tissues: Widely expressed across multiple human tissues, with highest expression in the kidney

  • Cancer cells: Expression varies by cancer type

    • Decreased expression in renal cell carcinoma (RCC), correlating with poor prognosis

    • Upregulated in nasopharyngeal carcinoma (NPC), correlating with advanced tumor node metastasis stage, recurrence, and decreased survival time

    • Varied expression in other cancer types, with higher expression correlating with better survival in breast, lung, kidney, and rectal cancers

This differential expression suggests context-dependent roles of TMEM52B in cancer progression, with potential tumor suppressor activity in some cancers and oncogenic activity in others.

What experimental systems are available for studying recombinant TMEM52B?

Several experimental platforms are available for studying recombinant TMEM52B:

  • Bacterial expression systems: E. coli-based expression of TMEM52B for functional studies

  • Cell culture models: Various cancer cell lines including:

    • Colorectal cancer cell lines (SW480, HCT-15)

    • Nasopharyngeal carcinoma cell lines (SUNE-1, S18)

  • In vivo xenograft models: Mouse models for tumor growth and metastasis assessment

  • Recombinant protein availability: Commercial recombinant partial TMEM52B protein (purity >85% by SDS-PAGE) produced in E. coli systems

For optimal storage and handling of recombinant TMEM52B:

  • Lyophilized forms typically maintain stability for 12 months at -20°C/-80°C

  • Liquid forms generally have a shelf life of 6 months at -20°C/-80°C

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol is recommended for long-term storage

What are the divergent roles of TMEM52B in different cancer types?

TMEM52B exhibits contrasting functions across different cancer types, presenting an intriguing paradox in cancer biology:

Cancer TypeTMEM52B RoleSupporting EvidenceKey Mechanisms
Renal Cell CarcinomaTumor suppressorDecreased expression correlates with poor prognosis and VHL mutations Possibly through modulation of E-cadherin stability
Colon CancerTumor suppressorInhibits tumor growth and early metastasis Inhibits soluble E-cadherin generation and EGFR activation
Nasopharyngeal CarcinomaOncogenicHigh expression correlates with advanced tumor stage, recurrence, and poor survival Promotes AKT phosphorylation via PGK1 interaction; TMEM52B-P20 promotes E-cadherin degradation
Esophageal Squamous Cell CarcinomaOncogenicPromotes progression through YAP-mediated EMT Enhances epithelial-mesenchymal transition

This dual nature may be explained by:

  • Tissue-specific molecular contexts and signaling networks

  • Differential expression of TMEM52B isoforms

  • Unique protein-protein interactions in different cellular environments

How do TMEM52B ECD-derived peptides exert anti-cancer activity?

TMEM52B extracellular domain (ECD)-derived peptides demonstrate significant anti-cancer activity through multiple mechanisms:

  • Inhibition of soluble E-cadherin generation:

    • Peptides bind directly to E-cadherin ECD

    • Interfere with the interaction between soluble E-cadherin and EGFR

    • Maintain intact E-cadherin at organized cell-cell junctions

  • Reduction of cancer cell survival and invasion:

    • Decrease phosphorylation of ERK1/2 and AKT

    • Reduce anchorage-independent growth

    • Inhibit invasion capacity

  • Modulation of β-catenin activity:

    • Maintain E-cadherin stability

    • Enhance phosphorylation of β-catenin at Ser33/37/Thr41

    • Reduce phosphorylation at Ser552 and Ser675

    • Decrease transcriptional activity of β-catenin

  • In vivo efficacy:

    • Peptides fused to the Fc domain of human IgG1 efficiently inhibit tumor growth in colon cancer xenograft models

    • Reduce survival of circulating tumor cells in early metastasis models

These peptides represent a promising platform for novel anti-cancer therapeutics targeting E-cadherin/EGFR interactions.

How do TMEM52B isoforms P18 and P20 differentially affect cancer progression?

TMEM52B-P18 and TMEM52B-P20 isoforms exhibit both overlapping and distinct functions in cancer progression:

FeatureTMEM52B-P18TMEM52B-P20
Subcellular LocalizationConfined to cytoplasmPresent at both cell membrane and cytoplasm
Effect on Cell GrowthPromotes cancer cell growthPromotes cancer cell growth
Effect on MetastasisModerate promotionStronger promotion of metastasis
Drug ResistanceContributes to drug resistanceContributes to drug resistance
Molecular MechanismEnhances AKT phosphorylation via PGK1 interaction1. Enhances AKT phosphorylation via PGK1 interaction (cytoplasmic)
2. Promotes E-cadherin ubiquitination and degradation via NEDD4 (membrane-localized)

The differential effects on metastasis are attributed to their distinct subcellular localization patterns. While both isoforms can activate AKT signaling in the cytoplasm through PGK1 interaction, only the membrane-localized TMEM52B-P20 facilitates E-cadherin degradation by promoting its interaction with NEDD4 E3 ubiquitin ligase .

This functional divergence suggests that targeted therapies aimed at specific TMEM52B isoforms may provide more precise treatment strategies for patients with different metastatic potentials.

What methodologies are most effective for studying TMEM52B protein interactions?

Several robust methodologies have proven effective for investigating TMEM52B interactions:

  • Co-immunoprecipitation (Co-IP):

    • Successfully used to demonstrate TMEM52B interaction with E-cadherin

    • Requires co-expression of myc-tagged TMEM52B and E-cadherin in HEK293 cells

    • Effective for detecting both isoforms' interactions with partner proteins

  • Immunofluorescence analysis:

    • Valuable for visualizing subcellular localization differences between isoforms

    • Demonstrates E-cadherin expression at organized cell-cell junctions

    • Shows differential localization of TMEM52B-P18 (cytoplasmic) versus TMEM52B-P20 (membrane and cytoplasmic)

  • Protein stability assessment:

    • Proteasome inhibitors (e.g., MG132) used to evaluate TMEM52B's effect on E-cadherin stability

    • Transfecting cells with TMEM52B-specific shRNA followed by proteasome inhibitor treatment

  • Reporter assays:

    • β-catenin transcriptional activity evaluated using reporter plasmids

    • AP-1 cis-element reporter assays for assessing signaling pathway activation

  • In vitro binding assays:

    • Direct binding between TMEM52B ECD-derived peptides and E-cadherin ECD

    • Competition assays to demonstrate interference with E-cadherin-EGFR interaction

These methods collectively provide comprehensive insights into TMEM52B's interactome and mechanisms of action.

How does TMEM52B suppression affect cellular signaling pathways?

TMEM52B suppression triggers multiple signaling cascades that promote cancer progression:

  • MAPK pathway activation:

    • Increased phosphorylation of JNK and ERK1/2

    • Enhanced phosphorylation of c-Jun and ATF-2

    • Upregulated expression of cyclin D1

  • PI3K/AKT pathway stimulation:

    • Elevated phosphorylation of AKT

    • Increased expression of anti-apoptotic factors (bcl-2, survivin)

  • EMT induction:

    • Upregulation of mesenchymal markers (vimentin, α-smooth muscle actin, integrin α5, Slug)

    • Downregulation of epithelial markers (E-cadherin, α-catenin)

  • EGFR signaling enhancement:

    • Increased EGFR phosphorylation at Tyr1068

    • Enhanced response to exogenous EGF stimulation

    • EGFR-dependent activation of downstream signaling pathways

  • β-catenin activation:

    • Reduced E-cadherin stability

    • Enhanced β-catenin transcriptional activity

Experimental evidence shows these pathways are functionally interconnected, as EGFR knockdown reverses the effects of TMEM52B suppression on JNK, ERK1/2, and AKT phosphorylation, demonstrating EGFR dependency in TMEM52B-mediated signaling .

What are the experimental considerations for producing functional recombinant TMEM52B?

Producing functional recombinant TMEM52B requires careful attention to several technical aspects:

  • Expression system selection:

    • E. coli systems are suitable for producing partial TMEM52B proteins (particularly soluble domains)

    • Eukaryotic systems (e.g., wheat germ) may be preferable for full-length transmembrane proteins to ensure proper folding and post-translational modifications

  • Buffer composition optimization:

    • Recommended storage in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Addition of 5-50% glycerol for long-term storage stability

  • Protein purification strategy:

    • Affinity tags should be chosen based on experimental requirements

    • Purification to >85% homogeneity by SDS-PAGE is achievable

  • Validation of functionality:

    • Binding assays with known interaction partners (e.g., E-cadherin)

    • Reporter assays to evaluate signaling pathway modulation

    • Cell-based assays to assess biological activity

  • Storage and handling considerations:

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Lyophilized forms offer extended stability (12 months) compared to liquid forms (6 months)

For experiments requiring specific TMEM52B domains, the extracellular domain (ECD) has shown particularly promising bioactivity and may be prioritized for recombinant production .

How can TMEM52B serve as a prognostic biomarker in cancer?

TMEM52B shows significant potential as a prognostic biomarker across multiple cancer types:

Implementation considerations for clinical application:

  • Immunohistochemistry (IHC) protocols for tissue microarrays have been validated

  • Expression cutoffs for "high" versus "low" groups need standardization

  • Combination with other biomarkers may enhance prognostic value

Future development should focus on prospective validation in larger patient cohorts and standardization of detection methods.

What is the therapeutic potential of TMEM52B ECD-derived peptides?

TMEM52B ECD-derived peptides demonstrate significant therapeutic potential through multiple mechanisms:

  • Anti-cancer activity spectrum:

    • Reduced cancer cell survival, invasion, and anchorage-independent growth

    • Inhibited tumor growth in colon cancer xenograft models

    • Reduced survival of circulating tumor cells in early metastasis models

  • Key structural features:

    • The shared amino acid sequence (CLTTDWVH) between peptides may represent the pharmacophore

    • Fc fusion enhances stability and efficacy in vivo

  • Molecular mechanisms:

    • Direct binding to E-cadherin ECD

    • Interference with soluble E-cadherin-EGFR interaction

    • Maintenance of intact E-cadherin at cell-cell junctions

    • Reduction of β-catenin transcriptional activity

  • Safety profile:

    • Preliminary experiments show no substantial toxicity toward normal intestinal cells

    • FHC normal colonic epithelial cells and CCD-18Co normal colon tissue cells maintained viability after peptide treatment

  • Development pathway:

    • Further characterization of anti-cancer activity spectrum across various models

    • Identification of surrogate biomarkers for activity

    • Pharmacophore refinement and optimization

    • Further safety and efficacy evaluations in advanced preclinical models

These peptides represent a promising platform for developing novel cancer therapeutics targeting the E-cadherin/EGFR axis.

How do contradicting findings about TMEM52B's role in different cancers inform research approaches?

The contradictory findings regarding TMEM52B's role across different cancer types present both challenges and opportunities for research:

  • Context-dependent functional analysis:

    • Investigation of tissue-specific co-factors that may modify TMEM52B function

    • Examination of signaling network differences between cancer types

    • Analysis of epigenetic regulation of TMEM52B in different cellular contexts

  • Isoform-specific investigations:

    • Differential expression analysis of TMEM52B-P18 versus TMEM52B-P20 across cancer types

    • Development of isoform-specific antibodies and detection methods

    • Exploration of isoform-specific targeting strategies

  • Methodological standardization:

    • Consistent use of validated antibodies and detection methods

    • Clear specification of which isoform(s) are being studied

    • Comprehensive reporting of subcellular localization

  • Integrative approaches:

    • Combined analysis of TMEM52B with interacting partners (E-cadherin, EGFR, PGK1, NEDD4)

    • Multi-omics profiling to capture broader molecular context

    • Systems biology modeling of TMEM52B networks

  • Translational considerations:

    • Cancer-type specific biomarker development

    • Personalized therapeutic approaches based on TMEM52B status and isoform expression

    • Consideration of TMEM52B in drug resistance mechanisms

These approaches can transform the apparent contradictions into deeper insights about context-dependent protein function in cancer biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.