Recombinant Human Uncharacterized protein C12orf69 (C12orf69)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
SMCO3; C12orf69; Single-pass membrane and coiled-coil domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SMCO3
Target Protein Sequence
MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDG TIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVI LGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAIL GAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK
Uniprot No.

Target Background

Database Links

HGNC: 34401

KEGG: hsa:440087

UniGene: Hs.220931

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is C12orf69/SMCO3 and where is it expressed in human tissues?

    C12orf69, now officially named SMCO3 (single-pass membrane protein with coiled-coil domains 3), is an evolutionarily conserved protein encoded by the SMCO3 gene located on the negative strand of chromosome 12 (12p12.3, spanning position chr12:14,803,723-14,814,182) . The gene contains 2 exons flanking a single intron and has a total length of 10,460 base pairs.

    Expression analysis reveals that SMCO3 is expressed at low levels across multiple human tissues with highest expression observed in:

    TissueRelative Expression Level
    KidneyHigh
    LiverHigh
    SpleenHigh
    CervixLow
    Connective tissueLow
    EyeLow
    LungLow
    ProstateLow

    Interestingly, SMCO3 shows higher expression in certain cancer types, particularly chondrosarcoma and clear-cell renal cell carcinoma . Expression patterns are developmentally regulated, with detection primarily in fetal and adult stages but not in embryoid bodies, blastocysts, or juvenile developmental stages.

  • What antibodies and detection methods are available for C12orf69/SMCO3 research?

    Several validated antibodies are commercially available for C12orf69/SMCO3 detection:

    AntibodyHost/TypeValidated ApplicationsReactivityRecommended DilutionsReference
    26099-1-APRabbit PolyclonalWB, IHC, ELISAHuman, Mouse, RatWB: 1:500-1:1000, IHC: 1:50-1:500
    FNab01014Rabbit PolyclonalELISA, IHC, WBHuman, Mouse, RatWB: 1:500-1:1000, IHC: 1:50-1:500

    For detection using Western blot, the observed molecular weight is approximately 25 kDa . The antibodies typically recognize the full-length protein and show high specificity.

    Additional methods for C12orf69 detection and quantification include:

    • qPCR assays (Bio-Rad PrimePCR™ validated primers)

    • RNA-seq for expression analysis

    • Mass spectrometry-based proteomic approaches

  • What is known about the gene structure and variants of C12orf69/SMCO3?

    The SMCO3 gene (previously known as C12orf69) has the following structural characteristics:

    • Located on chromosome 12p12.3 on the negative strand

    • Genomic span: 10,460 base pairs (chr12:14,803,723-14,814,182)

    • Gene structure: 2 exons separated by 1 intron

    • Promoter region: 1,100 base pairs long, beginning 961 base pairs upstream of the 5' UTR and overlapping the first exon

    • Only a single isoform has been identified to date

    Regarding variants:

    • 2,152 known nucleotide-level variants have been documented

    • 27 are coding synonymous single nucleotide polymorphisms

    • Approximately 75% of SNPs occur within the intronic region

    • No disease-associated variants have been identified to date

    Gene neighborhood analysis shows SMCO3 is flanked by WW domain binding protein 11 (WBP11) and Ecto-ADP-ribosyltransferase 4 (ART4) on the minus strand and overlaps with C12orf60 on the plus strand .

Advanced Research Questions

  • What experimental approaches can be used to elucidate the function of C12orf69/SMCO3?

    Given that C12orf69/SMCO3 is largely uncharacterized, multiple complementary approaches should be employed to determine its function:

    Genetic Approaches:

    • CRISPR-Cas9 mediated knockout/knockdown: Similar to the approach used for C2orf69 in zebrafish models , CRISPR-Cas9 can be used to create knockout cell lines or animal models of SMCO3

    • Overexpression studies: Using expression vectors containing the SMCO3 coding sequence to identify gain-of-function phenotypes

    • Conditional expression systems: To study temporal aspects of SMCO3 function

    Proteomic Approaches:

    • Co-immunoprecipitation followed by mass spectrometry to identify interaction partners

    • Proximity labeling methods (BioID, APEX) to identify proteins in close proximity to SMCO3

    • AlphaFun structural-alignment-based annotation: As described in recent research, this approach can predict protein function based on structural similarity using deep-learning-predicted protein structures

    Cellular Localization Studies:

    • Immunofluorescence microscopy with validated antibodies

    • Subcellular fractionation followed by Western blotting

    • Fluorescent tagging (GFP, mCherry) of SMCO3 for live-cell imaging

    Functional Genomics:

    • RNA-seq analysis of SMCO3-deficient versus control cells

    • ChIP-seq to identify potential transcriptional regulation

    • Phenotypic screens in knockout models

    Structural Biology:

    • X-ray crystallography or cryo-EM to determine protein structure

    • In silico structure prediction using AlphaFold2 followed by function prediction

  • How can I determine potential cellular pathways involving C12orf69/SMCO3 based on current evidence?

    While direct evidence for SMCO3 pathway involvement is limited, several approaches can help predict its cellular role:

    Homology-Based Approaches:
    C2orf69, another uncharacterized ORF protein, has been studied in relation to an autoinflammatory syndrome. Research shows C2orf69:

    • Bears homology to esterase enzymes

    • Is loosely associated with mitochondria

    • Affects mitochondrial membrane potential and oxidative respiration

    • Controls levels of glycogen branching enzyme 1 (GBE1)

    • When inactivated in zebrafish, causes lethality due to epileptic seizures preceded by brain inflammation

    Similar analyses could be performed for SMCO3 to determine if it shares functional characteristics with C2orf69.

    Co-Expression Analysis:

    1. Identify genes with expression patterns highly correlated with SMCO3 across tissues and conditions

    2. Perform pathway enrichment analysis on these co-expressed genes

    3. Use the AlphaFun approach, which has successfully annotated 99% of the human proteome including previously uncharacterized proteins

    Protein Domain Analysis:
    The name SMCO3 (single-pass membrane protein with coiled-coil domains 3) indicates:

    • It likely contains a transmembrane domain

    • Contains coiled-coil domains, often involved in protein-protein interactions

    • Analysis of these domains can provide functional clues

    Differential Expression Analysis:
    Comparing expression in normal vs. disease states (particularly in tissues with highest expression: kidney, liver, spleen) can provide insights into potential pathways.

  • How should I validate antibody specificity for C12orf69/SMCO3 research?

    Thorough validation of antibody specificity is crucial for reliable C12orf69/SMCO3 research. Follow these methodological steps:

    Western Blot Validation:

    1. Test the antibody in tissues known to express SMCO3 (kidney, liver, spleen based on expression data )

    2. Verify the detection of a single band at the expected molecular weight (25 kDa)

    3. Include knockout/knockdown controls if available to confirm specificity

    4. Test across multiple species if cross-reactivity is claimed (human, mouse, rat)

    Immunohistochemistry (IHC) Validation:

    1. Include positive control tissues (e.g., human colon tissue has been validated )

    2. Optimize antigen retrieval methods:

      • Test both TE buffer pH 9.0 and citrate buffer pH 6.0 as recommended

      • Compare different antibody dilutions (1:50-1:500)

    3. Include negative controls (primary antibody omission, isotype controls)

    4. Confirm staining pattern corresponds to expected subcellular localization

    Overexpression System Validation:

    1. Transfect cells with SMCO3 expression vectors

    2. Compare antibody signals between transfected and non-transfected cells

    3. Consider using tagged constructs (FLAG, HA, GFP) to validate with tag-specific antibodies

    Cross-Validation with Multiple Antibodies:

    1. Compare results using different antibodies targeting distinct epitopes

    2. Correlate protein detection with mRNA expression data

    3. Consider orthogonal detection methods (mass spectrometry)

  • What proteomics approaches are most suitable for studying C12orf69/SMCO3 interactions?

    Given the uncharacterized nature of C12orf69/SMCO3, advanced proteomics approaches can help identify interaction partners and functional pathways:

    Affinity Purification-Mass Spectrometry (AP-MS):

    1. Immunoprecipitate SMCO3 using validated antibodies

    2. Alternatively, express tagged SMCO3 (FLAG, HA, Strep) for affinity purification

    3. Analyze co-purified proteins using liquid chromatography-tandem mass spectrometry (LC-MS/MS)

    4. Compare to control IPs to identify specific interactors

    5. Validate key interactions using reciprocal IPs and co-localization studies

    Proximity-Based Labeling:

    1. Generate fusion proteins of SMCO3 with BioID or APEX2

    2. Express in relevant cell types

    3. Activate the enzyme to biotinylate proteins in proximity to SMCO3

    4. Purify biotinylated proteins and identify by MS

    5. This approach captures both stable and transient interactions

    Isotope Labeling Approaches:
    Similar to the 18O labeling approach used in neuronal proteome studies :

    1. Compare SMCO3-knockout versus wild-type cells

    2. Label peptides from one condition with 18O

    3. Mix samples and analyze by MS

    4. Identify differentially expressed proteins as potential pathway components

    Crosslinking Mass Spectrometry (XL-MS):

    1. Stabilize protein interactions with chemical crosslinkers

    2. Digest and enrich for crosslinked peptides

    3. Identify interaction interfaces

    4. This approach provides structural information about the interactions

    Data Analysis Recommendations:

    • Apply stringent statistical filters (e.g., significance analysis of microarrays (SAM) statistical technique with 1,000 permutations and a threshold fold change of 2)

    • Use Principal Component Analysis (PCA) for sample classification

    • Perform pathway enrichment analysis on identified interactors

  • What approaches can be used to investigate potential disease associations of C12orf69/SMCO3?

    To explore potential disease roles of this uncharacterized protein, consider these methodological approaches:

    Genetic Association Studies:

    1. Analyze genomic databases for variants in SMCO3 associated with disease phenotypes

    2. Examine data from genome-wide association studies (GWAS)

    3. Sequence SMCO3 in patient cohorts with suspected relevant phenotypes (based on expression pattern or homology to C2orf69, consider autoinflammatory disorders, mitochondrial disorders, or kidney/liver diseases)

    Expression Analysis in Disease Contexts:

    1. Compare SMCO3 expression between normal and disease tissues, particularly in:

      • Kidney, liver, and spleen (highest expression tissues)

      • Cancers where expression is elevated (chondrosarcoma and clear-cell renal cell carcinoma)

    2. Use techniques similar to those employed in osteoarthritis studies, where genome-wide expression was analyzed

    Functional Studies in Disease Models:

    1. Generate knockout/knockdown in relevant cell types

    2. Assess phenotypes related to known disease pathways

    3. Consider examining mitochondrial function, given C2orf69's association with mitochondria

    4. Investigate inflammatory responses, given the autoinflammatory phenotype associated with C2orf69 deficiency

    Patient Sample Analysis:

    1. Screen patient samples from relevant disease categories for SMCO3 expression abnormalities

    2. Perform immunohistochemistry on tissue microarrays spanning multiple diseases

    3. Analyze publicly available disease-specific transcriptomic and proteomic datasets

    Drug Response Association:
    Similar to studies examining gene expression correlation with gemcitabine sensitivity :

    1. Correlate SMCO3 expression with drug response profiles

    2. Investigate if SMCO3 expression affects therapeutic outcomes

  • How can advanced structural biology approaches help elucidate the function of C12orf69/SMCO3?

    Given the challenges of studying uncharacterized proteins, structural biology offers powerful insights into potential functions:

    AI-Based Structure Prediction:

    1. Use AlphaFold2 or RoseTTAFold to predict SMCO3 structure

    2. Apply the AlphaFun approach, which has successfully annotated 99% of the human proteome

    3. Perform structural alignment with proteins of known function

    4. Identify potential functional domains and catalytic sites

    Experimental Structure Determination:

    1. Express and purify recombinant SMCO3 protein

      • Consider using E. coli, insect, or mammalian expression systems

      • Optimize for solubility (test different tags, truncations)

    2. Apply structural biology techniques:

      • X-ray crystallography

      • Cryo-electron microscopy (cryo-EM)

      • Nuclear magnetic resonance (NMR) for smaller domains

    Structure-Function Analysis:

    1. Based on structural features, design point mutations of key residues

    2. Express mutant forms in cellular models

    3. Assess changes in localization, interaction partners, and cellular phenotypes

    4. Consider computational approaches like molecular dynamics simulations to predict functional mechanisms

    Integrative Structural Biology:
    Combine multiple approaches:

    1. Low-resolution techniques (small-angle X-ray scattering, SAXS)

    2. Crosslinking mass spectrometry to identify interaction interfaces

    3. Hydrogen-deuterium exchange mass spectrometry to study protein dynamics

    4. Computational modeling to integrate diverse structural data

  • What are the most effective CRISPR-Cas9 strategies for studying C12orf69/SMCO3 function?

    CRISPR-Cas9 technology offers powerful approaches to investigate the function of uncharacterized proteins like SMCO3:

    Complete Knockout Strategies:

    1. Design guide RNAs targeting early exons (SMCO3 has 2 exons)

    2. Recommended target sites:

      • Exon 1 (with care to avoid the promoter region that overlaps it)

      • Multiple guides to ensure complete knockout

    3. Verification methods:

      • PCR and sequencing of the targeted region

      • Western blot using validated antibodies to confirm protein loss

      • RT-qPCR to check mRNA levels

    Conditional Knockout Approaches:

    1. Flox the SMCO3 gene using loxP sites flanking critical exons

    2. Use tissue-specific or inducible Cre expression for temporal/spatial control

    3. Particularly valuable for studying in vivo functions or if complete knockout is lethal

    Knockin Strategies:

    1. Tag endogenous SMCO3 with reporters (GFP, mCherry) or affinity tags (FLAG, HA)

    2. Create point mutations in potential functional domains

    3. Use homology-directed repair (HDR) with appropriate donor templates

    Base and Prime Editing:
    For precise modification without double-strand breaks:

    1. Use base editors for C→T or A→G substitutions

    2. Apply prime editors for more diverse edits

    3. Particularly useful for studying specific domains or creating disease-relevant mutations

    Screening Approaches:

    1. Generate CRISPR-Cas9 libraries targeting:

      • Different regions of SMCO3

      • Genes potentially in the same pathway

    2. Screen for phenotypes of interest

    3. Use single-cell approaches to capture heterogeneity in response

    In Vivo Application:
    Similar to the C2orf69 zebrafish study :

    1. Create SMCO3 knockout in model organisms (mouse, zebrafish)

    2. Monitor phenotypes throughout development

    3. Assess tissue-specific effects, focusing on tissues with high expression (kidney, liver, spleen)

  • How can I explore transcriptional regulation of C12orf69/SMCO3?

    Understanding the transcriptional regulation of SMCO3 can provide insights into its biological role and disease associations:

    Promoter Analysis:

    1. The promoter region of SMCO3 spans 1,100 base pairs, beginning 961 base pairs upstream of the 5' UTR and overlaps the first exon

    2. Analyze this region for:

      • Transcription factor binding sites

      • CpG islands and potential methylation sites

      • Enhancer elements

      • Conserved regulatory motifs across species

    Epigenetic Profiling:

    1. Perform ChIP-seq for histone modifications associated with active (H3K4me3, H3K27ac) or repressed (H3K27me3) chromatin

    2. Analyze DNA methylation patterns using bisulfite sequencing

    3. Assess chromatin accessibility using ATAC-seq or DNase-seq

    4. Investigate three-dimensional chromatin organization using Hi-C or related techniques

    Transcription Factor Studies:

    1. Perform ChIP-seq for candidate transcription factors

    2. Use reporter assays with the SMCO3 promoter to identify regulatory elements

    3. Perform deletion/mutation analysis of the promoter region

    4. Consider yeast one-hybrid screens to identify transcription factors

    Expression Correlation Analysis:

    1. Identify transcription factors whose expression correlates with SMCO3 across tissues and conditions

    2. Analyze co-expression networks to identify potential regulators

    3. Examine expression changes during development, as SMCO3 is expressed in fetal and adult stages but not embryoid bodies or blastocysts

    Functional Validation:

    1. Modulate candidate transcription factors and assess SMCO3 expression

    2. Use CRISPR interference (CRISPRi) or activation (CRISPRa) to target the promoter region

    3. Validate regulatory interactions using gel shift assays (EMSA) and chromatin conformation capture techniques

    By employing these approaches, researchers can gain insights into the biological contexts where SMCO3 is active and potential pathways for therapeutic intervention in related diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.