Recombinant Human Uncharacterized protein C12orf70 (C12orf70)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing your specified tag.
Synonyms
SMCO2; C12orf70; Single-pass membrane and coiled-coil domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
SMCO2
Target Protein Sequence
MALTPTNLNNKMSLQMKMDCQEQQLTKKNNGFFQKLNVTEGAMQDLLKEIIKVDHILDRS DDEDDISSENPQTDFLHKGMLELEAEHDQDLSKQDKQETDVDEDPQASTSLQFSKKNLLE LCLKGMFLKLNYWNTKIGLQVKELGADYIDGTEKIDNIIKKINVTENTVKSLLKDMLTLK GQIEKLEDRGLDLDQGTSTEVNTCNEVYELKKKVIERLEDLCKNVELLSAKLRMYQMEAE DTDSHSSEEIDTEEMEALLPQAPASFLVQKSPPRNTAWKRALRIFIMFDVLTVTGLLCYI LFFGATFLFERVLLRMLGCRTTWDLREMREPFLNLEVEALLPS
Uniprot No.

Target Background

Database Links

HGNC: 34448

KEGG: hsa:341346

STRING: 9606.ENSP00000387617

UniGene: Hs.282121

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is C12orf70 and what is its current nomenclature?

C12orf70 (chromosome 12 open reading frame 70) is an uncharacterized protein encoded by a gene located on chromosome 12. The official gene symbol has recently been changed from C12orf70 to SMCO2 (Single-pass Membrane protein with Coiled-coil domains 2) . This nomenclature update reflects progress in understanding its structural characteristics, though its precise function remains incompletely defined.

The protein is referenced in several genetic databases, including the Global Variome shared LOVD (Leiden Open Variation Database). When working with this protein, researchers should be aware of both designations (C12orf70 and SMCO2) when conducting literature searches to ensure comprehensive results.

What experimental techniques are recommended for initial characterization of C12orf70?

Initial characterization of uncharacterized proteins like C12orf70 should follow a systematic approach:

  • Subcellular Localization Studies:

    • Immunofluorescence microscopy using antibodies against C12orf70 and organelle markers

    • Cellular fractionation followed by Western blotting

    • Expression of GFP-tagged C12orf70 followed by live-cell imaging

  • Expression Analysis:

    • qPCR to determine tissue distribution and expression levels

    • Western blotting to confirm protein expression

    • RNA-Seq to identify co-expressed genes that might suggest functional relationships

  • Basic Structural Analysis:

    • Secondary structure prediction using computational tools

    • Domain identification through sequence homology

    • Transmembrane topology prediction using algorithms like TMHMM

Similar approaches were successfully employed for characterizing C17orf80, another previously uncharacterized protein, which was found to be associated with mitochondrial nucleoids .

How can I design primers for C12orf70 expression analysis?

When designing primers for C12orf70/SMCO2 expression analysis, consider the following methodological approach:

  • Transcript Information Reference:

    • Use the NM_001145010.1 transcript reference sequence, which is documented in the LOVD database

    • Verify this is the most current reference sequence in NCBI

  • Primer Design Parameters:

    • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

    • Optimal primer length: 18-25 nucleotides

    • GC content: 40-60%

    • Melting temperature (Tm): 58-62°C with minimal difference between forward and reverse primers

    • Avoid secondary structures and primer-dimers

  • Controls and Validation:

    • Include housekeeping genes (GAPDH, β-actin) as internal controls

    • Validate primers using melt curve analysis

    • Confirm amplicon size by gel electrophoresis

    • Sequence the PCR product to verify specificity

This approach aligns with standard molecular biology protocols for expression analysis of poorly characterized genes.

What are effective strategies for generating recombinant C12orf70 protein?

Producing recombinant C12orf70 requires careful consideration of expression systems and purification strategies:

Expression System Selection:

Expression SystemAdvantagesLimitationsRecommended Tags
E. coliRapid growth, high yield, cost-effectivePotential improper folding, lack of post-translational modificationsHis6, GST, MBP
Mammalian cells (HEK293, CHO)Native folding, proper post-translational modificationsLower yield, higher cost, slowerHis6, FLAG, Fc
Insect cells (Sf9, Hi5)Post-translational modifications, high expressionModerate cost, complex setupHis6, Strep-tag II
Cell-free systemsRapid production, works with toxic proteinsLower yield, expensiveHis6, FLAG

Methodological Approach:

  • Construct Design:

    • Include affinity tags (His6, FLAG) for purification

    • Consider fusion partners (GST, MBP) to improve solubility

    • Include a protease cleavage site between tag and protein

  • Expression Optimization:

    • Test multiple expression conditions (temperature, induction time)

    • Screen for soluble protein expression

    • Analyze expression by SDS-PAGE and Western blotting

  • Purification Strategy:

    • Affinity chromatography based on chosen tag

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography for final polishing

  • Quality Assessment:

    • Purity: SDS-PAGE, mass spectrometry

    • Structure integrity: Circular dichroism

    • Functional assays based on predicted functions

Similar approaches have been used for other uncharacterized proteins like C17orf80, where biochemical assays helped determine its mitochondrial membrane association .

How can I design experiments to investigate potential protein-protein interactions of C12orf70?

To investigate C12orf70 protein interactions, implement a multi-layered approach:

  • In silico Prediction:

    • Use computational tools to predict potential interaction partners based on:

      • Sequence homology with known interacting proteins

      • Structural domains that mediate protein interactions

      • Co-expression patterns across tissues and conditions

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged C12orf70 in an appropriate cell line

    • Perform immunoprecipitation using anti-tag antibodies

    • Identify co-purified proteins by mass spectrometry

    • Include appropriate controls (empty vector, unrelated protein)

  • Proximity Labeling Methods:

    • BioID or TurboID: Fuse C12orf70 with a biotin ligase

    • APEX2: Fuse with an engineered peroxidase

    • Label proteins in proximity, then identify by streptavidin purification and MS

    This approach was successfully used to identify C17orf80 as a nucleoid-associated protein through proximity labeling of Twinkle, a core nucleoid protein .

  • Validation Methods:

    • Co-immunoprecipitation to confirm direct interactions

    • Fluorescence microscopy to verify co-localization

    • FRET/BRET to demonstrate physical proximity in living cells

    • Mammalian two-hybrid or split-luciferase assays

  • Functional Validation:

    • Knockdown/knockout studies to assess functional relevance

    • Mutational analysis of interaction interfaces

    • Phenotypic rescue experiments

These methodologies provide complementary data that strengthen confidence in identified interactions and help prioritize candidates for in-depth functional studies.

How can I assess the pathogenicity of C12orf70 variants?

Assessing pathogenicity of C12orf70 variants requires a systematic approach combining computational prediction, functional studies, and clinical correlation:

  • Variant Classification Framework:

    • Follow ACMG/AMP guidelines for variant classification

    • Consider population frequency, conservation, and in silico predictions

  • Computational Analysis:

    • Population databases: gnomAD, 1000 Genomes

    • Conservation analysis: PhyloP, GERP scores

    • Pathogenicity prediction tools: SIFT, PolyPhen-2, CADD

    • Splicing effect prediction: MaxEntScan, SpliceAI

  • Functional Validation:

    • Cell-based assays assessing protein function

    • RNA analysis for splicing variants

    • Protein stability and localization studies

    • CRISPR-based modeling in relevant cell types

  • Clinical Correlation:

    • Compare with known pathogenic variants (e.g., c.478A>T)

    • The c.478A>T variant (p.Lys160*) has been documented as pathogenic in a homozygous state

    • Document segregation in families

    • Phenotype consistency assessment

The LOVD database has documented a pathogenic variant (c.478A>T, p.Lys160*) in C12orf70 that was found in a homozygous state in affected individuals from a consanguineous Saudi Arabian family . This truncating variant serves as a reference for assessing other potentially pathogenic variants.

What experimental designs are suitable for functional validation of C12orf70 variants?

Functional validation of C12orf70 variants requires careful experimental design and multiple complementary approaches:

Comprehensive Functional Validation Strategy:

  • Expression Systems:

    • Overexpression of wild-type and variant C12orf70 in relevant cell lines

    • CRISPR-engineered cell lines with endogenous variants

    • Patient-derived cells (if available)

  • Functional Assays Based on Predicted Protein Function:

    • If membrane-associated (based on SMCO2 nomenclature):

      • Membrane integration assays

      • Membrane topology analysis

      • Protein-lipid interaction studies

  • Cellular Phenotype Analysis:

    • Compare wild-type vs. variant effects on:

      • Cell morphology and growth

      • Subcellular compartment structure and function

      • Stress response pathways

      • Cell viability and apoptosis

  • Single-Case Design Considerations:

    • Implement robust internal controls

    • Follow principles of replication for valid causal inferences

    • Include multiple measurements over time to establish experimental effects

    • Address threats to internal validity as outlined in single-case design technical documentation

    • Ensure active manipulation of independent variables with proper sequencing

  • RNA-Seq Analysis:

    • Compare transcriptional changes between wild-type and variant expression

    • Use statistical cutoffs (FDR ≤ 0.05, log fold change ≥ 2)

    • Apply pathway analysis tools (like IPA) to identify affected cellular processes

    • This approach has been successful in characterizing effects of genetic variants in other systems

This multi-level approach ensures robust functional assessment of C12orf70 variants and helps establish genotype-phenotype correlations.

How can I design CRISPR-Cas9 experiments to study C12orf70 function?

Designing effective CRISPR-Cas9 experiments for C12orf70 functional studies requires careful planning:

  • Guide RNA Design Strategy:

    • Target early exons to maximize disruption

    • Design multiple gRNAs (3-4) targeting different regions

    • Use design tools (CRISPOR, Benchling) to select guides with:

      • High on-target efficiency scores

      • Low off-target potential

      • Appropriate GC content (40-60%)

    • Consider the NM_001145010.1 transcript reference sequence

  • CRISPR Delivery System Selection:

    Delivery MethodAdvantagesLimitationsBest Application
    Plasmid transfectionSimple, economicalTransient, variable efficiencyHEK293, HeLa
    Lentiviral transductionStable integration, works in most cell typesBiosafety concernsPrimary cells, difficult-to-transfect lines
    RNP complexesReduced off-targets, no DNA integrationTransient, requires optimizationPrimary cells, therapeutic applications
    AAV vectorsIn vivo applicationsLimited packaging capacityAnimal models
  • Validation and Phenotypic Analysis:

    • Confirm editing by DNA sequencing (Sanger, NGS)

    • Verify protein knockout by Western blot

    • Assess phenotypic consequences using:

      • Cell viability assays

      • Proliferation measurements

      • Morphological analysis

      • Functional assays based on predicted function

      • Transcriptome analysis (RNA-Seq)

      • Proteome analysis

  • Controls and Rescue Experiments:

    • Include non-targeting gRNA controls

    • Generate isogenic control lines

    • Perform rescue experiments by re-expressing:

      • Wild-type C12orf70

      • Mutant variants

      • Orthologs from other species

This comprehensive approach will provide robust data on C12orf70 function while minimizing experimental artifacts and misinterpretation.

What approaches can be used to identify the subcellular localization and topology of C12orf70?

Determining subcellular localization and topology of C12orf70/SMCO2 requires multiple complementary approaches:

  • Immunofluorescence Microscopy:

    • Co-staining with organelle markers

    • Super-resolution microscopy for detailed localization

    • Live-cell imaging with fluorescently tagged protein

  • Biochemical Fractionation:

    • Differential centrifugation to separate cellular compartments

    • Density gradient separation

    • Western blot analysis of fractions

    • Protease protection assays to determine topology

  • Membrane Topology Analysis:

    • Protease accessibility assays with selectively permeabilized membranes

    • Glycosylation mapping with engineered glycosylation sites

    • Antibody accessibility assays similar to those used for C17orf80 :

      • Selective permeabilization with digitonin (permeabilizes plasma membrane and outer mitochondrial membrane)

      • Complete permeabilization with Triton X-100

      • Detection with antibodies against different protein domains

  • Computational Prediction Tools:

    • Transmembrane helix prediction (TMHMM, similar to analysis done for C17orf80)

    • Signal peptide prediction (SignalP)

    • Subcellular localization prediction (TargetP, DeepLoc)

  • Proximity Labeling Methods:

    • BioID/TurboID to identify proteins in proximity

    • APEX2 for spatially restricted labeling

Similar approaches were successfully used to determine that C17orf80 is a mitochondrial membrane-associated protein that interacts with nucleoids even when mtDNA replication is inhibited .

What statistical methods are appropriate for analyzing C12orf70 expression data?

When analyzing C12orf70 expression data, employ statistically robust methods appropriate for the experimental design:

  • For RT-qPCR Data:

    • Normalize to multiple reference genes (minimum 3) selected using algorithms like geNorm or NormFinder

    • Apply the 2^(-ΔΔCt) method for relative quantification

    • Use appropriate statistical tests:

      • Student's t-test for two-group comparisons

      • ANOVA with post-hoc tests for multiple groups

      • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

  • For RNA-Seq Data:

    • Quality control: FastQC, Trimmomatic

    • Alignment to reference genome: STAR, HISAT2

    • Quantification: Cufflinks, HTSeq, featureCounts

    • Differential expression: DESeq2, edgeR

    • Apply statistical thresholds:

      • False discovery rate (FDR) ≤ 0.05

      • Log fold change cutoff ≥ 2 (as used in similar studies)

  • For Protein Expression Data:

    • Western blot: Normalize to loading controls, use at least 3 biological replicates

    • Proteomics: Apply appropriate normalization and statistical testing based on experimental design

  • For Functional Studies:

    • Ensure adequate replication (minimum n=3 biological replicates)

    • Follow the three-replication criterion for single-case designs as specified in technical documentation

    • Calculate effect sizes where appropriate

  • Pathway and Network Analysis:

    • Use tools like IPA, STRING, or Reactome for pathway enrichment

    • Apply multiple testing correction (Bonferroni, Benjamini-Hochberg)

    • Visualize data using heat maps, volcano plots, and network diagrams

How can I integrate multi-omics data to understand C12orf70 function?

Integrating multi-omics data provides a comprehensive understanding of C12orf70 function through complementary perspectives:

  • Data Collection Strategy:

    • Genomics: Variant identification, evolutionary conservation

    • Transcriptomics: Expression patterns, co-expressed genes

    • Proteomics: Protein abundance, post-translational modifications

    • Interactomics: Protein-protein interactions

    • Metabolomics: Metabolic changes upon C12orf70 manipulation

  • Integration Methodologies:

    • Correlation-based approaches:

      • Pearson/Spearman correlation between datasets

      • Weighted gene co-expression network analysis (WGCNA)

    • Pathway-based integration:

      • Overlapping pathway enrichment

      • Network construction and analysis

    • Machine learning approaches:

      • Supervised learning for functional prediction

      • Unsupervised clustering for pattern identification

  • Computational Tools and Workflows:

    • Multi-omics data integration platforms:

      • Ingenuity Pathway Analysis (IPA)

      • OmicsNet

      • NetworkAnalyst

    • R/Bioconductor packages:

      • MultiDataSet

      • mixOmics

      • MOFA (Multi-Omics Factor Analysis)

  • Validation of Integrated Findings:

    • Experimental validation of key predictions

    • Independent dataset validation

    • Literature-based corroboration

This approach has been successfully applied in other systems, as seen in the RNA-Seq analysis methods described in research where statistical cutoffs (FDR ≤ 0.05, log fold change cutoff ≥ 2) were used alongside R commands (Bioconductor), MeV, and IPA for generating heat maps, network and pathway analysis .

What are common challenges in C12orf70 research and how can they be addressed?

Researching uncharacterized proteins like C12orf70 presents several technical challenges:

Antibody Specificity Issues:

  • Problem: Commercial antibodies may lack specificity or validation

  • Solutions:

    • Validate antibodies using knockout/knockdown controls

    • Use epitope-tagged recombinant proteins

    • Generate custom antibodies against multiple epitopes

    • Apply orthogonal detection methods to confirm results

Protein Expression and Solubility:

  • Problem: Difficulty expressing soluble, functional protein

  • Solutions:

    • Test multiple expression systems (bacterial, mammalian, insect)

    • Optimize codon usage for expression host

    • Use solubility-enhancing fusion tags (MBP, SUMO, GST)

    • Optimize buffer conditions for protein stability

    • Consider membrane protein extraction protocols if C12orf70/SMCO2 is membrane-associated

Functional Characterization:

  • Problem: Unknown function makes assay design challenging

  • Solutions:

    • Start with localization and interaction studies

    • Perform phenotypic screens after knockdown/knockout

    • Use homology and structural predictions to guide assay development

    • Consider evolutionary conservation to identify potential functions

    • Apply proximity labeling approaches similar to those used for C17orf80

Reproducibility Concerns:

  • Problem: Small-scale studies may lack statistical power

  • Solutions:

    • Follow guidelines for single-case design studies

    • Implement minimum three replications of experimental effects

    • Use appropriate controls and statistical methods

    • Document methodology thoroughly for reproducibility

This systematic approach to troubleshooting will enhance research quality and accelerate functional characterization of C12orf70.

How can I optimize transfection or transduction conditions for C12orf70 expression systems?

Optimizing transfection/transduction for C12orf70 expression requires systematic testing and careful optimization:

  • Cell Line Selection:

    • Choose cell lines based on:

      • Endogenous C12orf70 expression levels

      • Relevance to predicted function

      • Transfection efficiency characteristics

    • Test multiple cell lines in parallel (HEK293, HeLa, cell types relevant to phenotype)

  • Transfection Method Optimization:

    MethodOptimization ParametersCell TypesNotes
    Lipid-basedDNA:lipid ratio, incubation time, cell densityHEK293, HeLa, CHOBalance efficiency with toxicity
    ElectroporationVoltage, pulse duration, cell numberPrimary cells, suspension cellsRequires optimization for each cell type
    Calcium phosphateDNA amount, precipitation timeHEK293, fibroblastsCost-effective but variable
    NucleofectionProgram selection, DNA amountPrimary cells, hard-to-transfect linesHigh efficiency but expensive
  • Expression Vector Considerations:

    • Promoter selection (CMV, EF1α, tissue-specific)

    • Codon optimization for host cell

    • Inclusion of introns for enhanced expression

    • Selection of appropriate tag (position can affect function)

  • Transfection Optimization Protocol:

    • Perform matrix experiments varying:

      • Cell density (50-90% confluence)

      • DNA amount (0.5-2 μg per well in 6-well format)

      • Transfection reagent amount

      • Incubation times

    • Quantify efficiency using:

      • Reporter gene co-expression

      • Immunoblotting

      • Flow cytometry

  • For Viral Transduction:

    • Optimize MOI (multiplicity of infection)

    • Test different viral pseudotypes for target cell tropism

    • Consider inducible systems for toxic proteins

This methodical approach will identify optimal conditions for each specific experimental system, enhancing expression while minimizing cytotoxicity.

What emerging technologies could advance our understanding of C12orf70 function?

Several cutting-edge technologies offer promising avenues for elucidating C12orf70 function:

  • CRISPR Screening Technologies:

    • CRISPR activation/interference for gain/loss-of-function studies

    • Base editing for precise mutation introduction

    • Prime editing for flexible genomic modifications

    • CRISPR-based genetic interaction mapping

  • Advanced Imaging Techniques:

    • Super-resolution microscopy (STED, PALM, STORM)

    • Live-cell single-molecule tracking

    • Correlative light and electron microscopy (CLEM)

    • Label-free imaging methods

  • Structural Biology Approaches:

    • Cryo-electron microscopy for membrane protein structures

    • Integrative structural biology combining multiple data types

    • AlphaFold2 and other AI-based structure prediction tools

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Single-Cell Technologies:

    • Single-cell RNA-seq to identify cell type-specific functions

    • Single-cell proteomics for protein abundance variation

    • Spatial transcriptomics to determine tissue localization patterns

  • Proximity Proteomics Advancements:

    • Enhanced proximity labeling methods (TurboID, Split-BioID)

    • Spatially and temporally resolved interactomes

    • Similar approaches were pivotal in characterizing C17orf80

  • Organoid and In Vivo Models:

    • Patient-derived organoids to study disease variants

    • CRISPR-engineered animal models

    • Humanized models for translational research

These technologies, applied systematically and in combination, have the potential to comprehensively characterize C12orf70 function and its role in cellular processes and disease.

How can researchers contribute to the functional annotation of C12orf70?

Researchers can advance C12orf70 functional annotation through systematic approaches:

  • Consortium Participation and Data Sharing:

    • Join collaborative projects focused on uncharacterized proteins

    • Deposit data in public repositories (GEO, PRIDE, etc.)

    • Contribute variants to databases like LOVD

    • Adhere to FAIR data principles (Findable, Accessible, Interoperable, Reusable)

  • Systematic Functional Characterization:

    • Apply established pipelines for protein characterization:

      • Subcellular localization

      • Interaction networks

      • Expression patterns

      • Phenotypic effects of perturbation

    • Implement standardized assays for comparability across studies

  • Computational Annotation Methods:

    • Apply machine learning approaches for function prediction

    • Perform comparative genomics across species

    • Investigate protein domain architecture and conservation

    • Study co-expression networks to infer function

  • Disease Association Studies:

    • Investigate C12orf70 variants in patient cohorts

    • Document genotype-phenotype correlations

    • Perform case-control studies following established principles

    • Functionally characterize disease-associated variants

  • Integration with Multi-Omics Data:

    • Cross-reference with existing datasets

    • Apply integrative analytical approaches

    • Use network analysis to position C12orf70 in biological pathways

    • Implement data integration methods similar to those used in complementary research

By combining these approaches and sharing data openly, researchers can accelerate the functional annotation of C12orf70 and similar uncharacterized proteins, potentially uncovering new biological pathways and disease mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.