Recombinant Human Uncharacterized protein C19orf75 (C19orf75)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Uncharacterized Protein C19orf75 (C19orf75)

Recombinant Human Uncharacterized protein C19orf75 (C19orf75) is a protein that, as its name suggests, has not yet been characterized .

Basic Information

PropertyValue
Chemical NameRecombinant Human Uncharacterized protein C19orf75 (C19orf75)
CAS No.Not available
CBNumberCB115638264
Molecular FormulaNot available
Molecular Weight0
MDL NumberNot available

Research Guidelines for Presenting Data

When presenting data, it is important to consider whether the data is best presented within the text or as tables . Tables are useful for organizing data that is too detailed or complicated to be described adequately in the text, allowing the reader to quickly see the results . High-quality tables and figures increase the chance of acceptance of a manuscript for publication .

Choosing Between Tables, Figures, and Text

Use a TableUse a FigureUse Text
To show many and precise numerical values and other specific data in a small space To show trends, patterns, and relationships across and between datasets When you don't have extensive data to present
To compare and contrast data values with several shared characteristics or variables To summarize research results When putting your data into a table would mean creating a table with 2 or fewer columns
To show the presence or absence of specific characteristics To present a visual explanation of a sequence of events, procedures, or characteristics When the data that you are planning to present is irrelevant to the main study findings

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipment, and additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SIGLECL1; C19orf75; SIGLEC family-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SIGLECL1
Target Protein Sequence
MLPLLQLVPAKLLNSSCSLEKTLQCSCSFHGIPTPSVQWWMGGVPVGVDGMDGSLQVTST MLGPWANSTISLTEEPEMGMRLLCEGKNQNGTHALSILLMSRKSSLAAQAFVKGLIQGAI YAGIVIALLFLCLLPLIVKHIRKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVV ATFSESRILEKQDKRAS
Uniprot No.

Target Background

Database Links

HGNC: 26856

KEGG: hsa:284369

STRING: 9606.ENSP00000321249

UniGene: Hs.381087

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the basic characteristics and alternative nomenclature for C19orf75 protein?

C19orf75 (chromosome 19 open reading frame 75) is also known as SIGLECL1 (SIGLEC family-like protein 1), SIGLEC23P, and SIGLECP7. This protein has a molecular weight of approximately 21.3 kDa and is encoded by a gene located on chromosome 19. The protein is classified as part of the transmembrane protein family with potential relationships to the sialic acid binding Ig-like lectin (SIGLEC) family .

Key identifiers include:

ParameterIdentifier
UniProt IDQ8N7X8
NCBI ReferencesNM_173635, NP_775906
Gene ID284369
Protein FamilyTransmembrane

The "P" in SIGLEC23P and "P7" in SIGLECP7 may indicate these are pseudogene designations, suggesting potential evolutionary relevance to functional SIGLEC family members .

How is C19orf75 protein typically expressed and purified for research purposes?

For research applications, C19orf75/SIGLECL1 is commonly expressed in HEK293T cells using transient transfection systems. The methodological approach typically involves:

  • Transfection of HEK293T cells with an expression vector containing the C19orf75 coding sequence (often with C-terminal tags such as C-Myc/DDK for detection and purification)

  • Culture of transfected cells for 48 hours to allow protein expression

  • Cell lysis using modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, proteinase inhibitors, PMSF, and Na₃VO₄)

  • Clarification of lysate by centrifugation

  • Quantification of protein concentration using BCA protein assay

  • Storage of aliquoted lysates at -80°C for long-term stability

For expression validation, western blot analysis using anti-DDK (FLAG) antibodies (such as clone OTI4C5) is commonly employed to confirm successful expression .

What are the recommended storage and handling conditions for C19orf75 recombinant protein preparations?

Based on manufacturer recommendations for research-grade C19orf75/SIGLECL1 preparations, the following storage and handling protocols are advised:

  • Shipping: Preparations are typically shipped with dry ice or at ambient temperature depending on formulation

  • Long-term storage: Store protein lysates at -80°C (for liquid preparations) or -20°C (for lyophilized preparations)

  • Reconstitution: Lysate samples can be diluted with 2× SDS Sample Buffer when provided

  • Stability: When properly stored, preparations maintain stability for approximately 6-12 months from receipt

  • Critical consideration: Avoid repeated freeze-thaw cycles, which significantly compromise protein integrity and activity

  • Aliquoting: Upon initial thawing, divide preparations into single-use aliquots before refreezing

These conditions are particularly important for maintaining the structural integrity and functional activity of the protein for downstream applications.

What experimental validation methods are recommended to confirm C19orf75 expression in transfected cell models?

When working with C19orf75/SIGLECL1 in experimental systems, validation of proper expression is critical. Recommended validation methodologies include:

  • Western blot analysis using:

    • Anti-tag antibodies (anti-DDK/FLAG or anti-Myc) when using tagged constructs

    • Comparison between untransfected HEK293T cells (negative control) and C19orf75-transfected cells

    • Appropriate molecular weight confirmation (expected at approximately 21.3 kDa)

  • RT-PCR for transcript-level validation:

    • Design of specific primers targeting C19orf75 coding regions

    • Quantitative assessment using appropriate housekeeping gene controls

  • Immunofluorescence microscopy (for cellular localization):

    • Utilizing tagged constructs and corresponding antibodies

    • Co-localization studies with organelle-specific markers to determine subcellular distribution

Reference western blot validation data typically shows a clear band at approximately 21.3 kDa in transfected samples with no corresponding band in untransfected control lanes .

What evidence exists for C19orf75's potential role in breast cancer prognosis and how might researchers investigate this connection?

While C19orf75/SIGLECL1 is not explicitly identified in the provided patent information as a primary breast cancer biomarker, its investigation in this context could follow methodological approaches similar to those described for other prognostic RNA transcript biomarkers:

The patent literature suggests potential relevance of various RNA transcripts as biomarkers for predicting likelihood of long-term survival without breast cancer recurrence, providing a methodological framework that could be applied to investigating C19orf75 .

How might C19orf75 relate to epigenetic modifications in the context of disease development?

Based on reference to epigenome-wide association studies in the search results, researchers investigating potential epigenetic regulation of C19orf75 could employ the following methodological approach:

  • Analysis methods for DNA methylation:

    • Methylated CpG Island Recovery Assay (MIRA-chip)

    • Bisulfite sequencing of C19orf75 promoter and gene body regions

    • Illumina 450K/850K methylation arrays covering C19orf75-associated CpG sites

    • Identification of differentially methylated regions (DMRs) associated with C19orf75

  • Correlation with disease phenotypes:

    • Comparison of methylation patterns in cord blood mononuclear cells (CBMC) from subjects who later develop specific conditions versus those who do not

    • Longitudinal assessment of methylation changes over time

    • Integration with other epigenetic marks (histone modifications, chromatin accessibility)

  • Functional validation:

    • In vitro methylation studies using reporter assays

    • CRISPR-based epigenome editing to manipulate methylation at C19orf75-associated sites

    • Assessment of downstream effects on gene expression and cellular functions

This approach could potentially reveal epigenetic regulation mechanisms for C19orf75 that might be relevant to development of conditions such as asthma or other immune-related disorders.

What approaches can be used to investigate potential protein-protein interactions involving C19orf75?

For researchers interested in characterizing the interactome of C19orf75/SIGLECL1, several complementary methodological approaches are recommended:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged C19orf75 (utilizing available C-Myc/DDK-tagged constructs)

    • Perform immunoprecipitation using anti-tag antibodies

    • Analyze co-precipitated proteins by mass spectrometry

    • Validate interactions using reciprocal co-immunoprecipitation

  • Proximity-based labeling methods:

    • Generate BioID or TurboID fusions with C19orf75

    • Express in relevant cell types and provide biotin for labeling proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

    • Validate spatial proximity using fluorescence microscopy

  • Yeast two-hybrid screening:

    • Construct bait plasmids containing C19orf75 coding sequence

    • Screen against human cDNA libraries

    • Validate positive interactions using orthogonal methods

  • In silico prediction and structural analysis:

    • Homology modeling based on related SIGLEC family proteins

    • Prediction of functional domains and interaction motifs

    • Molecular docking simulations with potential binding partners

Given C19orf75's potential relationship to the SIGLEC family, special attention should be paid to interactions with sialic acid-containing glycoproteins and immune signaling molecules.

How might researchers investigate the functional significance of C19orf75 in cellular processes through gene editing approaches?

To elucidate the functional role of C19orf75/SIGLECL1 in cellular processes, researchers can employ several gene editing and knockdown strategies:

  • CRISPR-Cas9 knockout methodology:

    • Design guide RNAs targeting early exons of C19orf75

    • Generate complete knockout cell lines in relevant models (immune cells, epithelial cells)

    • Validate knockout efficiency at protein and mRNA levels

    • Conduct comprehensive phenotypic characterization (proliferation, migration, differentiation)

    • Perform transcriptomic and proteomic profiling to identify affected pathways

  • siRNA/shRNA knockdown approach:

    • Design target-specific siRNA or shRNA constructs

    • Optimize transfection conditions for target cell types

    • Validate knockdown efficiency by western blot and qRT-PCR

    • Assess acute phenotypic changes following transient knockdown

  • Inducible expression systems:

    • Generate doxycycline-inducible C19orf75 overexpression constructs

    • Establish stable cell lines with controlled expression

    • Perform time-course analyses following induction

    • Identify early response genes and pathways

  • Rescue experiments:

    • Reintroduce wild-type or mutant C19orf75 into knockout backgrounds

    • Assess which domains are critical for rescuing observed phenotypes

    • Create domain-specific mutations to map functional regions

These approaches can be particularly valuable for understanding the role of previously uncharacterized proteins like C19orf75 in cellular signaling, immune function, or disease pathogenesis.

What is known about the evolutionary conservation of C19orf75 and how can researchers investigate its functional implications?

The pseudogene designation in some of C19orf75's alternative names (SIGLEC23P, SIGLECP7) suggests interesting evolutionary considerations. Researchers can investigate evolutionary aspects through:

  • Comparative genomics approach:

    • Perform sequence alignment across species to identify conserved domains

    • Construct phylogenetic trees to trace evolutionary relationships with functional SIGLEC family members

    • Identify species-specific variations that might indicate functional divergence

    • Analyze syntenic regions to identify genomic context conservation

  • Functional domain analysis:

    • Identify conserved protein domains using tools like PFAM, InterPro, and SMART

    • Compare with canonical SIGLEC family proteins to identify retained vs. lost functional motifs

    • Predict functional implications of conserved regions

  • Expression pattern analysis:

    • Compare tissue-specific expression patterns across species

    • Identify developmental stage-specific expression profiles

    • Correlate expression with functional annotations

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify regions under purifying or positive selection

    • Map selection signatures to functional domains

    • Assess implications for protein function evolution

This evolutionary perspective can provide valuable insights into the potential functional significance of C19orf75, particularly given its relationship to the SIGLEC family, which plays important roles in immune regulation and cell-cell interactions.

What approaches are recommended for detecting endogenous C19orf75 expression in tissue samples?

For researchers interested in analyzing endogenous C19orf75/SIGLECL1 expression in tissue samples, several methodological approaches can be employed:

  • RNA-based detection methods:

    • RT-qPCR using validated primers targeting C19orf75 transcript

    • RNA-seq analysis with appropriate depth of coverage

    • In situ hybridization for spatial localization within tissue architecture

    • Single-cell RNA sequencing to identify cell type-specific expression patterns

  • Protein-based detection methods:

    • Immunohistochemistry (IHC) on formalin-fixed paraffin-embedded (FFPE) sections

    • Immunofluorescence for co-localization studies

    • Tissue microarray (TMA) analysis for high-throughput screening

    • Western blot analysis of tissue lysates

  • Technical considerations for challenging detection:

    • Use positive controls from transfected cell lysates to validate antibody specificity

    • Consider deglycosylation treatments if glycosylation affects antibody recognition

    • Validate antibody specificity using knockout/knockdown controls

    • Optimize fixation and antigen retrieval protocols for IHC applications

These approaches can be particularly valuable for translational research investigating C19orf75 expression in normal versus pathological tissue samples.

What methodological approaches can be used to investigate potential post-translational modifications of C19orf75?

Given its potential role as a transmembrane protein and relationship to the SIGLEC family, C19orf75/SIGLECL1 may undergo various post-translational modifications (PTMs) that could influence its function. Researchers can investigate these using:

  • Mass spectrometry-based PTM analysis:

    • Immunoprecipitate tagged C19orf75 from expression systems

    • Perform tryptic digestion and analyze by LC-MS/MS

    • Use neutral loss scanning for phosphorylation analysis

    • Apply specific enrichment strategies for glycosylation, ubiquitination, etc.

  • Glycosylation analysis:

    • Treat with specific glycosidases (PNGase F, Endo H) to identify N-linked glycosylation

    • Analyze migration shift on western blots pre/post-treatment

    • Use lectin-based affinity methods to characterize glycan structures

  • Phosphorylation mapping:

    • Treat cells with phosphatase inhibitors and/or specific kinase activators

    • Perform phospho-specific western blotting

    • Map phosphorylation sites using phospho-enrichment and MS/MS

  • Other potential modifications:

    • Assess lipid modifications using metabolic labeling

    • Investigate ubiquitination through ubiquitin pull-down assays

    • Analyze proteolytic processing using N- and C-terminal tag combinations

Understanding these modifications is crucial as they may significantly impact protein localization, stability, protein-protein interactions, and ultimately function of this uncharacterized protein.

How might large-scale genomic studies help elucidate the function of C19orf75?

Large-scale genomic approaches offer significant potential for understanding C19orf75/SIGLECL1 function through:

  • Genome-wide association studies (GWAS):

    • Analyze whether C19orf75 variants associate with specific phenotypes or diseases

    • Perform meta-analysis across multiple cohorts to increase statistical power

    • Investigate potential epistatic interactions with other genetic loci

    • Consider population-specific effects through stratified analyses

  • Expression quantitative trait loci (eQTL) analysis:

    • Identify genetic variants that influence C19orf75 expression levels

    • Map tissue-specific regulatory elements affecting expression

    • Correlate expression with disease phenotypes

    • Integrate with epigenomic data to understand regulatory mechanisms

  • Functional genomics screens:

    • Implement CRISPR-based screens to identify genetic interactions

    • Perform synthetic lethality screens in disease models

    • Apply pooled shRNA libraries to identify context-dependent functions

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and metabolomic data

    • Apply network analysis to position C19orf75 within biological pathways

    • Use machine learning approaches to predict functional associations

The information from search result regarding GWAS meta-analysis of recombination phenotypes could provide methodological insights for designing similar studies focused on C19orf75 function.

What considerations should researchers take into account when designing experiments to characterize previously unstudied functions of C19orf75?

When investigating novel functions of uncharacterized proteins like C19orf75/SIGLECL1, researchers should consider:

  • Strategic experimental design principles:

    • Begin with multiple cell types to identify context-specific functions

    • Prioritize physiologically relevant models over convenient cell lines

    • Include appropriate positive and negative controls for all assays

    • Design experiments to distinguish direct from indirect effects

    • Validate key findings using multiple orthogonal approaches

  • Functional hypothesis generation:

    • Leverage bioinformatic predictions of protein domains and motifs

    • Consider functions of related SIGLEC family members as starting hypotheses

    • Use gene ontology enrichment of co-expressed genes to predict biological processes

    • Apply protein-protein interaction network analysis to identify potential pathways

  • Context-dependent considerations:

    • Test function under various cellular stresses (inflammation, hypoxia, etc.)

    • Investigate developmental stage-specific roles if appropriate

    • Consider tissue-specific microenvironmental factors

    • Evaluate function in normal versus disease states

  • Technical validation strategies:

    • Confirm specificity of tools (antibodies, siRNAs, CRISPR guides)

    • Validate knockout/knockdown efficiency at both protein and mRNA levels

    • Include rescue experiments to confirm specificity of observed phenotypes

    • Document experimental conditions thoroughly to ensure reproducibility

These considerations can help researchers design rigorous experiments that effectively characterize novel functions of C19orf75 while minimizing experimental artifacts and misinterpretations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.