Recombinant Human Uncharacterized protein C1orf159 (C1orf159)

Shipped with Ice Packs
In Stock

Description

General Information

C1orf159, also known as Chromosome 1 Open Reading Frame 159, is a protein-coding gene located on chromosome 1 at position 1p36.33 . It has the LocusID 54991 . Other identifiers include NCBI: 54991, HGNC: 26062, Ensembl: ENSG00000131591, dbSNP: 54991, ClinVar: 54991, TCGA: ENSG00000131591 and COSMIC: C1orf159 .

Gene and Protein Features

The C1orf159 gene encodes a protein with unknown function . Research indicates that many proteins encoded by genes are yet to be fully characterized .

Expression and Function

C1orf159 is associated with Alpha-ketoglutarate-dependent dioxygenase AlkB-like (AlkB-like), Short-chain dehydrogenase/reductase SDR (SDR_fam), Pleckstrin homology domain (PH_domain), and Integrase, core catalytic domains . C11orf96 expression levels were highest in the kidney . C11orf96 was mainly concentrated in glomerular epithelial cells and may play a role in the formation of renal tubules during kidney development . C11orf96 was also expressed in the spleen, suggesting that this gene may be involved in some biological activities in the spleen . C11orf96 is widely distributed in the spleen, indicating that this protein may be involved in the body’s defense against foreign pathogens .

Associated Diseases

Diseases associated with C1orf159 include Congenital Myasthenic Syndrome .

Cognitive Performance

Some research has explored the impact of genetic variations, including those in the C1orf159 gene, on cognitive performance .

C11orf96 Gene

The C11orf96 gene encodes a protein of 124 amino acids . The protein sequence does not contain a signal peptide and does not have a transmembrane region . Protein interaction prediction analysis showed that the C11orf96 protein may interact with multiple proteins in the host, including the TMEM117 transmembrane protein that regulates endoplasmic reticulum (ER) stress, several other transmembrane proteins, E3 ubiquitin ligase, and zinc finger proteins . The C11orf96 protein consists of four structures: α-helix, β-turn, random coil, and extended chain, which account for 61%, 4%, 33%, and 2% of the protein structure, respectively .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance for dry ice shipping; additional fees will apply.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.

Synonyms
C1orf159; UNQ2998/PRO9739; Uncharacterized protein C1orf159
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-380
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
C1orf159
Target Protein Sequence
KSMENTVTRNSTAVINTQAEGTLSPPGLSSLPVVREWALTHTAQLPECCVDVVGVNASCP GASLCGPGCYRRWNADGSASCVRCGNGTLPAYNGSECRSFAGPGAPFPMNRSSGTPGRPH PGAPRVAASLFLGTFFISSGLILSVAGFFYLKRSSKLPRACYRRNKAPALQPGEAAAMIP PPQSSGNSSCRIPLWGFPSLGQSQGALWVCPQTGLPGSGSRPPLPGSPGDPPTRQGQGRI WLVPPALDLSWIWPAPPARPPLIPVTSMLFPVPETWGLQERRTHHDRADPQYLLLLEVQL HPRTDAAGLRQALLSSHRFSGAGSGGPKSQPVRKPRYVRRERPLDRATDPAAFPGEARIS NV
Uniprot No.

Target Background

Database Links

HGNC: 26062

KEGG: hsa:54991

STRING: 9606.ENSP00000368623

UniGene: Hs.235095

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the C1orf159 protein and where is it encoded in the human genome?

C1orf159 (chromosome 1 open reading frame 159) is a protein encoded by the C1orf159 gene located on the short arm of chromosome 1 at locus 1p36.33. The gene spans 34,247 base pairs at chromosome 1 position 1,081,818 to 1,116,089 on the reverse strand. It is classified as a protein-coding gene with NCBI Gene ID 54991 and UniProt ID Q96HA4 . The protein remains largely uncharacterized, though structural analyses indicate it contains a domain of unknown function (DUF4501) .

What are the key structural features of the C1orf159 protein?

The C1orf159 protein contains several noteworthy structural elements:

  • A domain of unknown function (DUF4501)

  • A transmembrane domain at positions 144-169

  • A signal peptide at positions 1-18

  • Multiple isoforms resulting from alternative splicing

The longest isoform (Q96HA4-1) is 380 amino acids with a molecular mass of 40.382 kDa . The protein is proline- and arginine-rich, while being poor in lysine and glutamic acid. It has an isoelectric point of 10.07, making it significantly more basic than the average human protein (pI of 7.36) . AlphaFold predictions suggest the structure is mainly composed of alpha helices .

What isoforms of C1orf159 have been identified and characterized?

Alternative splicing of the C1orf159 gene creates 5 distinct protein isoforms:

IsoformUniProt IDLength (aa)
1Q96HA4-1380
2Q96HA4-2185
3Q96HA4-3189
4Q96HA4-4198
5Q96HA4-5254

The longest transcript encodes an mRNA of 2,432 nucleotides with 12 exons . The promoter region has been predicted using UCSC Genome Browser to be 762 nucleotides long, including 434 nucleotides upstream of the transcriptional start site, exon 1, and a 298 nucleotide region of intron 1 .

What methods can be used to detect and quantify C1orf159 expression in different tissues?

Several methodological approaches can be used to detect and quantify C1orf159:

  • RNA-seq and microarray analysis: Multiple studies have employed these techniques to measure C1orf159 transcript levels across tissues. The Allen Brain Atlas datasets show differential expression patterns of C1orf159 in various brain regions .

  • RT-qPCR: Using specific primers targeting the conserved regions of C1orf159 transcripts. When designing primers, researchers should account for the multiple splice variants.

  • Western blotting: Commercial polyclonal antibodies against C1orf159 are available for protein detection . When selecting antibodies, consider the epitope location to ensure detection of your isoform of interest.

  • Immunohistochemistry/Immunocytochemistry: Antibodies against C1orf159 have been validated for these applications, allowing for spatial localization studies .

  • ELISA: For quantitative detection of C1orf159 in biological samples .

How should I optimize recombinant expression of C1orf159 for functional studies?

Optimizing recombinant expression of C1orf159 requires careful consideration of several factors:

  • Expression system selection: Based on available commercial recombinant proteins, yeast expression systems have been successfully used for C1orf159 production . For mammalian post-translational modifications, consider HEK293 or CHO cells.

  • Construct design considerations:

    • Include the complete open reading frame (ORF) sequence from RefSeq database (XM_019289686.1)

    • Consider whether to include or exclude the signal peptide (amino acids 1-18) depending on your localization goals

    • For membrane studies, ensure the transmembrane domain (positions 144-169) is preserved

    • Select appropriate tags that won't interfere with the transmembrane domain

  • Storage and stability: The recombinant protein has been reported to maintain stability for 6 months at -20°C/-80°C in liquid form and 12 months in lyophilized form. Add 5-50% glycerol and aliquot to minimize freeze-thaw cycles .

  • Reconstitution protocol: Centrifuge before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and consider adding glycerol to a final concentration of 50% for long-term storage .

What methods are appropriate for studying the post-translational modifications of C1orf159?

C1orf159 undergoes multiple post-translational modifications that can be studied using these methodological approaches:

  • Phosphorylation at S18:

    • Phospho-specific antibodies

    • Mass spectrometry with phosphopeptide enrichment

    • In vitro kinase assays to identify responsible kinases

  • N-Glycosylation at N92, N104, N111, and N128 :

    • Glycosidase treatment (PNGase F) followed by mobility shift analysis

    • Lectin affinity chromatography

    • Mass spectrometry with glycopeptide enrichment

    • Site-directed mutagenesis of N-glycosylation sites (N→Q substitutions)

  • Ubiquitination at K170 :

    • Immunoprecipitation under denaturing conditions followed by ubiquitin detection

    • Mass spectrometry with K-ε-GG remnant antibody enrichment

    • Proteasome inhibitor treatment to accumulate ubiquitinated forms

Each PTM analysis should include appropriate controls and validation experiments to ensure specificity and reproducibility of results.

What is currently known about the biological function of C1orf159?

Despite being classified as an "uncharacterized protein," emerging evidence provides clues about C1orf159's potential functions:

  • Subcellular localization: The presence of a signal peptide (residues 1-18) and a transmembrane domain (residues 144-169) suggests C1orf159 is a single-pass membrane protein that may function in cellular compartmentalization or membrane-associated processes .

  • Disease associations: C1orf159 has been identified as an unfavorable prognosis marker for renal and liver cancer, while serving as a favorable prognosis marker for urothelial cancer . This differential association suggests tissue-specific functions.

  • Environmental response: The Poll'Omic database indicates C1orf159 transcript levels change in response to PM2.5 exposure in blood tissue under normal conditions , suggesting potential involvement in environmental stress responses.

  • Conserved features: The highly conserved cysteine residues within the DUF4501 domain indicate potential importance for protein structure, possibly through disulfide bond formation .

To fully elucidate its function, researchers should consider combining transcriptomic, proteomic, and genetic approaches, including CRISPR-Cas9 knockout/knockdown studies and interactome analyses.

What tissue and cell-type specific expression patterns have been observed for C1orf159?

C1orf159 shows distinct expression patterns across tissues and developmental stages:

  • Brain expression: The Allen Brain Atlas datasets reveal differential expression of C1orf159 across brain regions in both adult human and mouse tissues . Expression patterns also vary during developmental stages as shown in both microarray and RNA-seq data from developing human brain tissue .

  • Harmonizome data: Analysis from the Harmonizome database indicates C1orf159 has 3,731 functional associations spanning 8 biological categories extracted from 61 datasets .

  • Methodological considerations for expression analysis:

    • When analyzing RNA-seq data, account for all possible splice variants

    • For tissue-specific studies, single-cell RNA-seq can reveal cell-type specific expression

    • Consider validation of expression patterns using independent methods (RT-qPCR, in situ hybridization)

    • Compare expression across developmental stages when appropriate

These expression patterns provide important context for functional studies and may guide hypothesis generation about tissue-specific roles of C1orf159.

How is C1orf159 expression regulated at the transcriptional and post-transcriptional levels?

While specific regulatory mechanisms for C1orf159 are not fully characterized, several approaches can be used to investigate its regulation:

  • Transcriptional regulation:

    • The promoter region has been predicted to span 762 nucleotides, including 434 nucleotides upstream of the transcriptional start site

    • Transcription factor binding site analysis using tools like JASPAR or TRANSFAC

    • ChIP-seq data analysis for histone modifications and transcription factor binding

    • Reporter gene assays with promoter constructs to identify key regulatory elements

  • Post-transcriptional regulation:

    • Alternative splicing produces 5 protein isoforms, suggesting splicing regulation is important

    • Analysis of RNA-binding protein interaction sites within C1orf159 mRNA

    • Investigation of potential microRNA binding sites in the 3'UTR

    • mRNA stability assays following actinomycin D treatment

  • Epigenetic regulation:

    • DNA methylation at specific CpGs has been associated with lung function trajectories, suggesting epigenetic control of C1orf159 expression

    • Methodologies include bisulfite sequencing, methylation-specific PCR, and correlation analysis between methylation and expression levels

What is the evidence for C1orf159's role in cancer prognosis and how can researchers investigate this further?

Evidence suggests C1orf159 has complex roles in cancer prognosis that vary by cancer type:

  • Current evidence:

    • Unfavorable prognosis marker for renal and liver cancer

    • Favorable prognosis marker for urothelial cancer

  • Methodological approaches to investigate cancer associations:

    • Survival analysis: Kaplan-Meier survival curves stratified by C1orf159 expression levels

    • Multivariate analysis: Cox proportional hazards models adjusting for clinical covariates

    • Expression correlation: Analysis of correlation between C1orf159 and known oncogenes/tumor suppressors

    • Functional assays: Effects of C1orf159 knockdown/overexpression on cancer cell proliferation, migration, invasion, and apoptosis

    • Pathway analysis: Identification of signaling pathways affected by C1orf159 modulation in cancer cells

  • Tissue-specific considerations:

    • Investigate the opposing prognostic associations in different cancer types

    • Determine if specific isoforms have different effects in different tissues

    • Analyze co-expression networks in cancer-specific contexts

How is C1orf159 associated with lung function and respiratory conditions?

Research has identified associations between C1orf159 and respiratory function:

  • DNA methylation and lung function:

    • A study investigating epigenome-wide associations found that DNA methylation at specific CpG sites in C1orf159 at pre-adolescence was associated with lung function trajectories

    • In males, DNA methylation at cg21131402 in the C1orf159 gene promoter showed a statistically significant association with FEV1/FVC trajectories

  • Environmental response:

    • Poll'Omic database indicates C1orf159 transcript changes in response to PM2.5 exposure in blood tissue , suggesting potential involvement in air pollution response mechanisms

  • Methodological approaches for respiratory research:

    • Longitudinal studies: Track C1orf159 expression/methylation and lung function over time

    • Exposure models: In vitro exposure of respiratory epithelial cells to pollutants

    • Animal models: Analyze C1orf159 expression in mouse models of respiratory conditions

    • Methylation-expression relationships: Correlate methylation status with expression levels

    • Functional validation: Use CRISPR/Cas9-mediated epigenetic editing to modify methylation at specific CpGs

What evidence connects C1orf159 to autoimmune conditions like rheumatoid arthritis?

Emerging evidence suggests potential involvement of C1orf159 in autoimmune conditions:

  • Genetic association studies:

    • A genome-wide PC sliding-window approach identified a significant window containing AGRN, C1orf159, ISG15, and SAMD11 associated with rheumatoid arthritis

    • This window was ranked second in significance across all identified windows

  • Methodological considerations for autoimmune research:

    • Genotype-phenotype correlation: Analyze specific SNPs within or near C1orf159 and their association with disease severity

    • Expression analysis: Compare C1orf159 expression in patient vs. healthy control samples

    • Functional studies: Investigate effects of C1orf159 modulation on immune cell function

    • Animal models: Analyze C1orf159 expression in models of rheumatoid arthritis

    • Drug response correlation: Determine if C1orf159 expression or specific genotypes correlate with treatment response

How can CRISPR-Cas9 technology be optimized for studying C1orf159 function?

CRISPR-Cas9 technology offers powerful approaches for investigating C1orf159 function:

  • Knockout strategies:

    • Design sgRNAs targeting early exons (particularly exons 1-3) to ensure disruption of all isoforms

    • Consider targeting conserved functional domains like the DUF4501 region

    • Create conditional knockouts in tissue-specific contexts to address potential lethality

    • Verify knockout efficiency using both genomic sequencing and protein/RNA expression analysis

  • Knockin approaches:

    • Engineer epitope tags (e.g., FLAG, HA) for endogenous protein detection

    • Create fluorescent protein fusions for live-cell imaging studies

    • Introduce specific mutations to disrupt PTM sites (S18, N92, N104, N111, N128, K170)

    • Consider the impact of the transmembrane domain when designing fusion proteins

  • CRISPRi/CRISPRa applications:

    • Use CRISPRi (dCas9-KRAB) to repress C1orf159 expression without genomic alterations

    • Apply CRISPRa (dCas9-VP64) to upregulate expression in low-expressing cell types

    • Target promoter regions previously identified (434 nucleotides upstream of TSS)

  • Epigenetic editing:

    • Use dCas9 fused to DNA methyltransferases or demethylases to modify methylation at specific CpGs associated with lung function

What interactome analysis approaches are most appropriate for identifying C1orf159 binding partners?

Several complementary approaches can reveal C1orf159's interaction network:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged C1orf159 (FLAG, HA, or BioID) in relevant cell types

    • Perform crosslinking to stabilize transient interactions

    • Use appropriate detergents to solubilize membrane-associated complexes

    • Include appropriate controls (empty vector, unrelated membrane protein)

    • Consider both N- and C-terminal tags to capture different interaction surfaces

  • Proximity labeling approaches:

    • BioID or TurboID fusions with C1orf159 for in vivo biotinylation of proximal proteins

    • APEX2 fusion for rapid, spatially-restricted labeling

    • Optimize labeling conditions (biotin concentration, labeling time)

    • Separate experiments for different cellular compartments (may require organelle fractionation)

  • Yeast two-hybrid (Y2H) adaptations:

    • Consider split-ubiquitin Y2H for membrane protein interactions

    • Use soluble domains of C1orf159 for traditional Y2H

    • Screen against domain-specific libraries relevant to predicted functions

  • Co-immunoprecipitation validation:

    • Validate high-confidence interactions with reciprocal co-IP experiments

    • Use endogenous antibodies when possible to confirm physiological relevance

    • Include appropriate negative controls and detergent optimization

How can researchers investigate the evolutionary conservation and divergence of C1orf159?

Evolutionary analysis provides important functional insights for uncharacterized proteins:

  • Comparative genomics approaches:

    • Identify orthologs across species using HomoloGene (ID: 51678) and OMA databases

    • Compare synteny of genomic regions containing C1orf159 to identify conserved gene clusters

    • Analyze conservation of specific protein domains, especially DUF4501

    • Study rate of evolution using dN/dS ratios to identify regions under selective pressure

  • Sequence analysis methodologies:

    • Multiple sequence alignment of orthologs to identify conserved residues and motifs

    • Analysis of cysteine conservation patterns within the DUF4501 domain

    • Identification of conserved PTM sites across species

    • Prediction of functional motifs using tools like ELM or MEME

  • Structural comparisons:

    • Compare AlphaFold predicted structures across species

    • Identify structurally conserved regions that may indicate functional importance

    • Use homology modeling to predict functions based on structural similarities

  • Example application:

    • A homologo gene analysis indicates the existence of a homolog in other species, such as the C1orf159 homolog in Corvus cornix cornix (Hooded crow)

    • Comparison of human C1orf159 with these orthologs can provide insights into functionally important regions

What bioinformatic pipelines are most effective for analyzing C1orf159 in large-scale genomic and transcriptomic datasets?

Effective bioinformatic analysis of C1orf159 requires custom pipelines that account for its unique characteristics:

  • RNA-seq data analysis:

    • Implement splice-aware aligners (STAR, HISAT2) to capture all isoforms

    • Use transcript-level quantification tools (Salmon, Kallisto) to distinguish between the 5 known isoforms

    • Apply DESeq2 or edgeR for differential expression analysis with appropriate covariates

    • Consider specialized pipelines for single-cell RNA-seq when analyzing tissue heterogeneity

  • Genomic data integration:

    • For GWAS analysis, consider variable-sized sliding-window approaches as demonstrated in rheumatoid arthritis studies

    • Implement principal component analysis to account for linkage disequilibrium patterns

    • Use polygenic risk score methods that incorporate multiple variants in the C1orf159 region

  • Methylation data analysis:

    • Process raw methylation data with specialized pipelines (minfi for array data, methylKit for bisulfite sequencing)

    • Implement both regional and single-CpG analysis approaches

    • Correlate methylation with expression data using tools like ELMER

    • Analyze differentially methylated regions (DMRs) across conditions

  • Multi-omics integration:

    • Apply tools like MultiPLIER, DIABLO, or MOFA for integrating C1orf159 data across multiple omics layers

    • Use network methods to identify modules containing C1orf159 across datasets

How can researchers resolve contradictory findings about C1orf159 function across different studies?

When faced with contradictory findings, consider these methodological approaches:

  • Context-dependent function analysis:

    • Systematically compare experimental conditions across studies (cell types, treatments, disease states)

    • Test C1orf159 function across multiple cell types to identify tissue-specific effects

    • Investigate isoform-specific functions that may explain contradictory results

    • Examine potential interacting partners that might modulate function in different contexts

  • Methodological validation:

    • Replicate key experiments using multiple complementary techniques

    • Validate antibody specificity using knockout controls

    • Cross-validate expression data with multiple platforms (RNA-seq, qPCR, proteomics)

    • Assess the impact of different statistical methods on interpretation of results

  • Meta-analysis approaches:

    • Perform formal meta-analysis of available datasets using random-effects models

    • Apply Bayesian methods to incorporate prior probability in analysis

    • Use Fisher's method or Stouffer's Z-score method to combine p-values across studies

    • Consider publication bias in analysis of contradictory findings

  • Specific example of resolving contradictions:

    • The contradictory cancer prognostic associations (positive in urothelial cancer, negative in renal and liver cancer) could be investigated using multi-cancer datasets with uniform analytics to identify molecular features explaining the difference

What systems biology approaches can best illuminate the pathway context of C1orf159?

Systems biology offers powerful tools to place C1orf159 in its broader biological context:

  • Network analysis methods:

    • Construct protein-protein interaction networks centered on C1orf159 and its binding partners

    • Apply algorithms like WGCNA to identify co-expression modules containing C1orf159

    • Use Bayesian networks to infer causal relationships

    • Implement network propagation algorithms to predict functional associations

  • Pathway enrichment methodologies:

    • Apply both ORA (Over-Representation Analysis) and GSEA (Gene Set Enrichment Analysis)

    • Use tissue-specific pathway databases to account for context-dependent functions

    • Consider pathway topology in analysis using tools like SPIA or PathwayCommons

    • Implement methods like decoupleR for transcription factor activity inference

  • Multi-scale modeling approaches:

    • Integrate transcriptomic, proteomic, and metabolomic data for comprehensive pathway modeling

    • Apply constraint-based modeling to predict effects of C1orf159 perturbation

    • Use agent-based modeling for cellular behavior prediction

    • Implement dynamic models to capture temporal aspects of C1orf159 function

  • Visualization tools:

    • Use Cytoscape with appropriate plugins for network visualization and analysis

    • Implement R packages like pathview for pathway visualization

    • Apply dimension reduction techniques (t-SNE, UMAP) to visualize C1orf159 in multi-dimensional data

How can C1orf159 be leveraged as a biomarker in clinical and environmental health studies?

C1orf159 shows promise as a biomarker in several contexts:

  • Cancer prognostic biomarker development:

    • Develop tissue-specific prognostic panels incorporating C1orf159 expression

    • Evaluate C1orf159 protein levels in liquid biopsies (circulating tumor cells, exosomes)

    • Assess methylation status of specific CpGs in cell-free DNA as surrogate markers

    • Design prospective validation studies with appropriate statistical power

  • Environmental exposure assessment:

    • Monitor C1orf159 transcript changes in response to PM2.5 and other pollutants

    • Develop blood-based expression panels for environmental exposure assessment

    • Compare sensitivity and specificity against established biomarkers

    • Integrate with other omics markers for improved predictive power

  • Respiratory function prediction:

    • Develop epigenetic age calculators incorporating C1orf159 methylation status

    • Design longitudinal studies to validate predictive power for lung function trajectories

    • Create multivariate models combining genetic, epigenetic, and expression data

    • Implement machine learning approaches for prediction refinement

  • Methodological considerations:

    • Standardize sample collection, processing, and analysis protocols

    • Include appropriate technical and biological controls

    • Validate results across multiple cohorts and populations

    • Consider combinations of markers rather than individual biomarkers

What novel therapeutic strategies might target C1orf159 or its regulatory mechanisms?

Despite being uncharacterized, several therapeutic targeting strategies can be considered:

  • Protein modulation approaches:

    • Develop antibodies targeting extracellular domains for function modulation

    • Design small molecules targeting the transmembrane domain or protein-protein interactions

    • Use proteolysis-targeting chimeras (PROTACs) for controlled degradation

    • Implement RNA interference therapeutics (siRNA, antisense oligonucleotides)

  • Gene expression modulation:

    • Design epigenetic drugs targeting specific methylation sites associated with disease

    • Develop CRISPR-based therapeutics for precise genomic or epigenomic editing

    • Use small molecules to modulate transcription factor binding at the promoter

    • Implement splice-switching oligonucleotides to favor beneficial isoforms

  • Pathway-based interventions:

    • Target upstream regulators or downstream effectors identified through systems biology

    • Develop combination therapies addressing multiple nodes in the pathway

    • Design context-specific interventions based on tissue expression patterns

    • Implement feedback-controlled dosing based on biomarker response

  • Personalized medicine applications:

    • Stratify patients based on C1orf159 genetic variants or expression profiles

    • Tailor treatments based on predicted response patterns

    • Monitor intervention efficacy using C1orf159 as a biomarker

    • Adjust therapeutic strategies based on temporal changes in expression or modification

What are the most promising research directions for understanding C1orf159's role in human health and disease?

Several high-priority research directions warrant investigation:

  • Comprehensive functional characterization:

    • Generate and phenotype knockout models in relevant cell types and organisms

    • Perform unbiased interactome analysis to identify binding partners

    • Conduct subcellular localization studies under various conditions

    • Implement CRISPR screens to identify synthetic lethal interactions

  • Disease-specific mechanisms:

    • Investigate the contrasting roles in different cancer types

    • Explore the mechanisms underlying associations with lung function

    • Examine potential involvement in respiratory responses to environmental exposures

    • Validate genetic associations with rheumatoid arthritis through functional studies

  • Structure-function relationships:

    • Determine high-resolution structures of C1orf159 protein domains

    • Investigate the role of the conserved cysteine residues in the DUF4501 domain

    • Map functional regions through systematic mutagenesis

    • Explore conformational dynamics and their functional implications

  • Multi-omics integration:

    • Implement comprehensive multi-omics profiling in relevant disease models

    • Develop computational frameworks to integrate diverse data types

    • Apply causal inference methods to identify key regulatory mechanisms

    • Construct predictive models incorporating genetic, epigenetic, and expression data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.