Recombinant Human Uncharacterized protein C1orf185 (C1orf185)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Uncharacterized protein C1orf185, also known as chromosome 1 open reading frame 185, is a protein-coding gene in humans . The C1orf185 gene is located on chromosome 1 in humans . While it is known to be expressed in the human body, it is considered a lowly expressed protein, with occasional expression in the circulatory system .

Basic Information

PropertyValue
Gene NameC1orf185 (Chromosome 1 Open Reading Frame 185)
SpeciesHomo sapiens (Human)
Gene ID284546
FunctionUncharacterized
LocationChromosome 1

Homology and Evolution

C1orf185 is conserved across a variety of species, with the highest conservation observed in primates . A table of C1orf185 orthologs across species is shown below :

Genus and SpeciesCommon NameTaxonomic GroupDate of Divergence (MYA)Accession NumberSequence Length (aa)Sequence Identity (Global)Sequence Similarity (Global)
Homo sapiensHumanPrimates0NP_001129980.1199100%100%
Pongo abeliiSumatran orangutanPrimates15.76PNJ53823.119593.50%95.50%
Cebus capucinus imitatorCapuchinPrimates43.2XP_017404303.122977.00%79.60%
Galeopterus variegatusSunda flying lemurDermoptera76XP_008578352.120373.70%77.90%
Oryctolagus cuniculusRabbitLagomorpha90XP_008263491.122569.90%76.40%
Dipodomys ordiiOrd's kangaroo ratRodentia90XP_012877642.118852.20%59.40%
Mastomys couchaSouthern multimammate mouseRodentia90XP_03123403726351.50%61.50%
Mus musculusHouse mouseRodentia90NP_001186019.122647.40%59.50%
Peromyscus leucopusWhite-footed mouseRodentia90XP_028745885.129541%48.20%
Phyllostomus discolorPale spear-nosed batChiroptera96XP_028367083.119173.40%80.40%
Myotis davidiiDavid's myotisChiroptera96XP_006768446.119671.40%78.40%
Equus caballusHorsePerissodactyla96XP_023485921.124363.80%68.30%
Muntiacus muntjakIndian muntjacArtiodactyla96KAB0362285.120059.40%65.90%
Hipposideros armigerGreat roundleaf batChiroptera96XP_019487867.115754.90%59.20%
Tursiops truncatusBottlenose dolphinArtiodactyla96XP_033708766.118954.10%59.00%
Sarcophilus harrisiiTasmanian devilDasyuromorhpia159XP_031825005.133318.20%27.70%
Ornithorhynchus anatinusPlatypusMonotremata180XP_02890227130926.80%37.40%
Pelodiscus sinensisChinese softshell turtleReptilia312XP_025042106.18907.40%11.40%
Gopherus evgoodeiSinaloan thornscrub tortoiseReptilia312XP_030429802.17774.00%6.30%
Chrysemys picta belliiWestern painted turtleReptilia312XP_023960730.17483.70%5.80%

Additional Information

For more information, consult these resources:

  • NCBI Gene database

  • GeneCards

  • Open Targets Genetics

  • Cardiovascular Disease Knowledge Portal

  • NCBI Genome Data Viewer

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
C1orf185; Uncharacterized protein C1orf185
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
C1orf185
Target Protein Sequence
MASPKGFFNYLTYFLAAGAVTLGIGFFALASALWFLICKRREIFQNSKFKAIDERCRQRP SMAKIKSHSQCVFISRNFHTGRFQLQEEQRKKEAAHIKAIKDHSKDEPQLATKNIICDPS ETSSTTNRSSVTLSLSTLPSDSYYSQSIEAADDWFSDDSLVKRNSPMPSLGEPLMEKVFS YLSTISLEEGTESVLNDTL
Uniprot No.

Target Background

Database Links

HGNC: 28096

KEGG: hsa:284546

STRING: 9606.ENSP00000360824

UniGene: Hs.176177

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are optimal for recombinant C1orf185 production?

When expressing C1orf185, researchers should consider several expression systems based on their specific research goals:

Commercial protein synthesis services offer C1orf185 production starting at approximately $99 plus $0.30 per amino acid with delivery possible in as little as two weeks . This option may be preferable for researchers requiring small amounts without investing in expression system development.

How can researchers verify the identity and purity of recombinant C1orf185?

Verification of recombinant C1orf185 requires a multi-method approach:

  • SDS-PAGE analysis: Confirms approximate molecular weight (~22.4 kDa) and initial purity assessment . Remember that the apparent weight may vary depending on expression tags and post-translational modifications.

  • Western blotting: Initially using anti-tag antibodies if fusion tags were employed (His, GST, FLAG, etc.) or commercially available/custom-made antibodies against C1orf185 peptides.

  • Mass spectrometry verification:

    • MALDI-TOF to confirm the molecular weight with high accuracy

    • LC-MS/MS peptide mapping for sequence coverage verification

    • Analysis of post-translational modifications if expressed in eukaryotic systems

  • N-terminal sequencing: Edman degradation for definitive N-terminal sequence confirmation.

  • Functional validation: While challenging for uncharacterized proteins, binding assays with predicted partners or activity assays based on computational predictions can provide functional verification.

A robust quality control workflow should include at minimum: SDS-PAGE with Coomassie staining (aiming for >90% purity), western blot confirmation, and mass spectrometry verification of protein identity.

What computational approaches can predict potential functions of C1orf185?

Function prediction for uncharacterized proteins like C1orf185 requires integrating multiple computational approaches:

  • Sequence-based prediction:

    • Homology detection using PSI-BLAST, HHpred, or HMMER

    • Motif identification using PROSITE, PRINTS, or PFAM

    • Domain architecture analysis using InterProScan

    • Transmembrane topology prediction with TMHMM or Phobius

  • Structure-based approaches:

    • 3D structure prediction using AlphaFold2 or RoseTTAFold

    • Structure comparison with known proteins using DALI or TM-align

    • Binding site prediction using CASTp or SiteMap

    • Molecular dynamics simulations to study dynamic properties

  • Network-based methods:

    • Protein-protein interaction prediction using STRING or PrePPI

    • Co-expression analysis to identify functionally related genes

    • Phylogenetic profiling to identify evolutionarily co-occurring genes

  • Integrative approaches:

    • Gene Ontology term prediction using tools like DeepGOPlus

    • Pathway association prediction

    • Disease association prediction

These approaches have successfully characterized hypothetical proteins in other organisms, as demonstrated in studies of Clostridium difficile where researchers identified potential functions and drug target candidates using a similar methodology .

How should researchers approach subcellular localization studies for C1orf185?

Determining subcellular localization is a critical step toward understanding protein function:

  • In silico prediction:

    • Use specialized tools like DeepLoc, TargetP, and PSORT

    • Analyze for targeting sequences (signal peptides, nuclear localization signals, etc.)

    • Consider evolutionary conservation of targeting sequences

  • Fluorescent protein fusion strategies:

    • Create both N- and C-terminal GFP (or other fluorescent protein) fusions

    • Express in relevant cell types (considering tissue expression patterns)

    • Co-localize with known organelle markers

    • Consider using photo-activatable fluorescent proteins for dynamic studies

  • Immunofluorescence microscopy:

    • Generate specific antibodies against C1orf185

    • Validate antibody specificity using overexpression and knockdown controls

    • Perform co-localization studies with compartment markers

  • Biochemical fractionation:

    • Perform subcellular fractionation experiments

    • Analyze fractions by Western blotting

    • Include proper fraction markers as controls

  • Proximity labeling approaches:

    • BioID or APEX2 fusion proteins to identify proximal proteins in living cells

    • Correlation with known proteins of defined localization

Given the potential membrane association of C1orf185, particular attention should be paid to membrane fractionation techniques and co-localization with various membrane compartments.

What methods are most effective for identifying C1orf185 interacting partners?

Identifying protein-protein interactions is crucial for uncharacterized proteins:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged C1orf185 in relevant cell types

    • Use tandem affinity purification to reduce non-specific binding

    • Identify co-purifying proteins by mass spectrometry

    • Apply stringent statistical analysis to distinguish true interactors

    • Include appropriate controls (unrelated tagged protein, untransfected cells)

  • Proximity-dependent labeling:

    • BioID approach: Fusion of C1orf185 with BirA* biotin ligase

    • APEX2 approach: Fusion with engineered peroxidase

    • These methods label proteins in close proximity to C1orf185 in living cells

    • Particularly valuable for membrane proteins or transient interactions

  • Crosslinking mass spectrometry (XL-MS):

    • Use chemical crosslinkers of different lengths and specificities

    • Identify crosslinked peptides by specialized mass spectrometry methods

    • Provides direct evidence of physical proximity

  • Yeast two-hybrid (Y2H) screening:

    • Use C1orf185 as bait against human cDNA libraries

    • Consider membrane-based Y2H systems if transmembrane topology is confirmed

    • Validate interactions through orthogonal methods

  • Co-immunoprecipitation validation:

    • Confirm key interactions in relevant cell types

    • Test both overexpressed and endogenous interactions when possible

    • Include reciprocal co-IP validation

Similar approaches have helped characterize previously uncharacterized proteins in bacterial systems, providing insights into their biological roles and potential as drug targets .

How can researchers design effective knockdown/knockout experiments for C1orf185 functional analysis?

Designing loss-of-function studies requires careful planning:

  • CRISPR-Cas9 knockout design:

    • Design multiple guide RNAs targeting early exons

    • Consider essential domains predicted by computational analysis

    • Use tools like CRISPOR or Benchling for guide RNA design

    • Include controls for off-target effects

    • Design strategies for knockout verification (genomic PCR, RT-PCR, Western blotting)

  • RNAi approaches:

    • Design multiple siRNAs or shRNAs targeting different regions

    • Test knockdown efficiency at mRNA and protein levels

    • Include appropriate negative controls

    • Consider inducible systems for temporal control

  • Experimental design considerations:

    • Perform experiments in relevant cell types where C1orf185 is normally expressed

    • Include rescue experiments to confirm specificity

    • Design comprehensive phenotypic readouts based on predicted function

    • Consider compensatory mechanisms in stable knockout systems

  • Analysis approaches:

    • Transcriptomic analysis to identify dysregulated pathways

    • Proteomic analysis to detect changes in protein levels or modifications

    • Cell biological assays based on predicted localization and function

    • Consider combinatorial knockdowns with predicted interaction partners

  • In vivo approaches:

    • Generate model organism knockouts where appropriate

    • Consider tissue-specific or inducible knockouts to bypass potential lethality

    • Design phenotypic analysis based on expression patterns and predicted function

Regardless of the approach, thorough validation of knockout/knockdown efficiency and specificity is essential for meaningful interpretation of results.

How should researchers approach post-translational modification analysis of C1orf185?

Post-translational modifications (PTMs) can significantly impact protein function:

  • Computational prediction:

    • Predict potential phosphorylation sites using tools like NetPhos

    • Identify potential glycosylation sites using NetNGlyc and NetOGlyc

    • Predict other modifications (ubiquitination, acetylation, SUMOylation, etc.)

    • Evaluate evolutionary conservation of predicted modification sites

  • Mass spectrometry-based PTM identification:

    • Express C1orf185 in mammalian cells to preserve physiologically relevant modifications

    • Enrich for modified peptides using specific techniques:

      • Phosphopeptides: TiO2, IMAC, or phospho-antibody enrichment

      • Glycopeptides: Lectin affinity or hydrazide chemistry

      • Ubiquitinated peptides: Anti-di-Gly antibody enrichment

    • Use high-resolution MS/MS for accurate PTM site assignment

    • Quantify modification stoichiometry where possible

  • Functional validation of PTMs:

    • Generate site-directed mutants (e.g., phosphomimetic or phosphodeficient)

    • Compare wild-type and mutant protein for:

      • Subcellular localization

      • Interaction partner binding

      • Protein stability

      • Functional activity (if known)

    • Use pharmacological inhibitors of modifying enzymes to confirm effects

  • Dynamic PTM analysis:

    • Analyze modifications under different cellular conditions

    • Investigate temporal changes in modification patterns

    • Study PTM crosstalk (how one modification affects others)

A comprehensive PTM analysis is particularly important for uncharacterized proteins as these modifications can provide valuable clues about regulation and function.

What genetic variant analysis approaches are relevant for C1orf185 research?

Genetic variation analysis can provide functional insights and disease relevance:

  • Variant identification and cataloging:

    • Analyze C1orf185 variants in population databases (gnomAD, 1000 Genomes)

    • Identify rare variants in disease databases (ClinVar, HGMD)

    • Sequence C1orf185 in specific patient cohorts of interest

  • Variant classification:

    • Determine variant pathogenicity using ACMG guidelines

    • Apply computational prediction tools (SIFT, PolyPhen, CADD)

    • Genetic testing services can detect sequence variants and copy number variants with >99% sensitivity

    • Variants classified as uncertain significance (VUS), likely pathogenic, or pathogenic should be reported

  • Functional impact assessment:

    • Create variant libraries using site-directed mutagenesis

    • Develop high-throughput functional assays based on predicted function

    • Assess protein expression, stability, localization, and interactions

    • Consider deep mutational scanning approaches

  • GWAS and eQTL analysis:

    • Identify SNPs in/near C1orf185 associated with traits or diseases

    • Analyze expression quantitative trait loci (eQTLs) affecting C1orf185 expression

    • Consider statistical thresholds similar to genome-wide studies (p < 5 × 10^-8)

  • Integrate with structural information:

    • Map variants onto predicted 3D structure

    • Assess potential impact on protein folding, stability, or interactions

    • Perform molecular dynamics simulations to predict variant effects

This approach aligns with current genomic medicine practices that integrate multiple lines of evidence to assess the significance of genetic variants .

How can researchers develop and validate specific antibodies against C1orf185?

Developing specific antibodies is crucial for many experimental approaches:

  • Antigen selection strategies:

    • Full-length protein: Provides comprehensive epitope coverage

    • Synthetic peptides: Target unique, soluble, and exposed regions

      • Use epitope prediction tools to identify optimal regions

      • Consider 15-25 amino acid peptides with high antigenicity scores

    • Recombinant fragments: Focus on soluble domains if membrane topology is confirmed

  • Production approaches:

    • Polyclonal antibodies: Faster production but variable specificity between bleeds

    • Monoclonal antibodies: Longer development time but consistent specificity

    • Recombinant antibodies: Defined sequence, renewable resource, no animal use

  • Validation strategy:

    • Western blotting: Using recombinant protein and endogenous expression

    • Immunoprecipitation: Confirm ability to pull down native protein

    • Immunofluorescence: Verify expected subcellular localization

    • Knockout/knockdown controls: Critical negative controls

    • Peptide competition assays: Confirm epitope specificity

    • Multiple antibody concordance: Different antibodies targeting different epitopes should show similar results

  • Documentation requirements:

    • Complete characterization of antibody performance across applications

    • Detailed methods for reproducibility

    • Appropriate positive and negative controls for each application

    • Documentation of validation using RRID (Research Resource Identifier)

For uncharacterized proteins like C1orf185, developing well-validated antibodies is particularly important as they enable many downstream experiments crucial for functional characterization.

What are the optimal cloning strategies for C1orf185 expression constructs?

Designing effective expression constructs requires careful consideration:

  • Vector selection based on research goals:

    • Bacterial expression: pET (T7 promoter), pGEX (GST fusion)

    • Mammalian expression: pcDNA, pCMV (constitutive), pTRE (inducible)

    • Lentiviral vectors: For stable cell line generation or difficult-to-transfect cells

    • Dual tag vectors: For tandem affinity purification

  • Tag selection and placement:

    • N-terminal tags: If C-terminus is predicted to be functional

    • C-terminal tags: If N-terminus contains signal peptides or is functionally important

    • Common tags: His6, FLAG, HA, GST, MBP (particularly for solubility)

    • Consider tag removal options (TEV or PreScission protease sites)

  • Codon optimization considerations:

    • Adapt to expression host codon bias

    • Remove rare codons or provide rare tRNA genes

    • Eliminate internal Shine-Dalgarno-like sequences in bacterial expression

    • Consider GC content and mRNA secondary structure

  • Cloning method selection:

    • Restriction enzyme cloning: Traditional but limited by restriction sites

    • Gibson Assembly: Seamless cloning for complex constructs

    • Gateway cloning: For rapid transfer between multiple vector systems

    • Golden Gate assembly: For assembly of multiple fragments

  • Design elements to include:

    • Kozak sequence for mammalian expression

    • Signal peptides if secretion is desired

    • Protease cleavage sites between protein and tags

    • Linker sequences to ensure proper protein folding

Careful design at this stage significantly impacts downstream success in expression and functional studies.

What are effective strategies for troubleshooting C1orf185 expression problems?

Protein expression troubleshooting requires systematic evaluation:

  • Low or no expression:

    • Verify construct sequence integrity

    • Test multiple expression conditions:

      • Temperature (typically lower for membrane proteins)

      • Induction parameters (concentration, timing, OD600)

      • Media composition (rich vs. minimal, supplements)

    • Try different host strains with specialized features

    • Consider fusion partners known to enhance expression (MBP, SUMO)

    • Test expression in different systems (bacterial, yeast, mammalian)

  • Insoluble expression/inclusion bodies:

    • Optimize lysis conditions (detergents, salt concentration)

    • Try mild solubilization and refolding protocols

    • Express at lower temperatures (16-20°C)

    • Co-express with chaperones

    • Consider native purification from inclusion bodies if refolding is successful

  • Protein degradation:

    • Add protease inhibitors during purification

    • Use protease-deficient host strains

    • Optimize buffer conditions (pH, salt, reducing agents)

    • Identify and remove unstable regions through construct redesign

    • Reduce time and temperature during purification steps

  • Poor purification yield:

    • Optimize binding and elution conditions

    • Check tag accessibility

    • Try alternative purification approaches

    • Consider on-column refolding for proteins in inclusion bodies

  • Systematic approach:

    • Design factorial experiments varying multiple parameters

    • Use quantitative measurements of protein yield

    • Document all conditions and results systematically

    • Consider structural predictions to guide construct optimization

This methodical approach is particularly important for uncharacterized proteins like C1orf185 where optimal conditions cannot be predicted from previous studies.

How can researchers assess the structural characteristics of C1orf185?

Structural characterization provides crucial insights into function:

This multi-method approach is essential for uncharacterized proteins, as no single method is universally successful for all protein types.

What mass spectrometry approaches are most informative for C1orf185 characterization?

Mass spectrometry offers powerful tools for protein characterization:

Mass spectrometry approaches have been successfully applied to characterize previously uncharacterized proteins, providing insights into their modifications, interactions, and functions .

What cell-based functional assays might be relevant for C1orf185 investigation?

Without known function, researchers should consider multiple functional screening approaches:

  • Cellular phenotype screening:

    • Proliferation and viability assays following overexpression or knockout

    • Morphological changes using high-content imaging

    • Cell cycle analysis to identify potential regulatory roles

    • Migration and invasion assays for potential roles in cell motility

    • Stress response assays under various cellular challenges

  • Signaling pathway analysis:

    • Reporter gene assays for major signaling pathways

    • Phosphorylation status of signaling proteins

    • Calcium flux measurements

    • Real-time signaling using FRET-based sensors

  • Metabolic function assessment:

    • Metabolic flux analysis using labeled substrates

    • Seahorse analysis for mitochondrial function

    • Glucose uptake and lactate production

    • Lipid metabolism assays

  • Gene expression effects:

    • RNA-seq following overexpression or knockout

    • Targeted gene expression analysis based on localization hints

    • Chromatin association if nuclear localization is observed

  • Systematic approach:

    • Begin with broad phenotypic screens

    • Follow up with more specific assays based on initial results

    • Include appropriate positive controls for assay validation

    • Consider cell type-specific functions based on expression patterns

For uncharacterized proteins, an unbiased screening approach combined with hypothesis-driven experiments based on computational predictions offers the best strategy for functional discovery.

How should researchers integrate multi-omics data to better understand C1orf185 function?

Multi-omics integration provides comprehensive insights:

  • Data types to consider:

    • Genomics: Variation in C1orf185 gene and regulatory regions

    • Transcriptomics: Expression patterns across tissues and conditions

    • Proteomics: Protein abundance, interactions, and modifications

    • Metabolomics: Metabolic changes upon C1orf185 perturbation

    • Phenomics: Phenotypic outcomes of gene manipulation

  • Integration approaches:

    • Correlation-based methods: Identify relationships between different data types

    • Network-based integration: Construct multi-layer networks

    • Machine learning approaches: Supervised or unsupervised classification

    • Causal modeling: Identify directional relationships between features

  • Specific methodologies:

    • Proteogenomics: Connect genetic variation to protein expression

    • Expression quantitative trait loci (eQTLs) identification

    • Protein QTLs (pQTLs) for post-transcriptional regulation

    • Mendelian Randomization for causal inference

  • Functional validation:

    • Prioritize hypotheses generated from integrated analysis

    • Design targeted validation experiments

    • Iterate between computational prediction and experimental validation

Similar multi-omics approaches have been successfully applied in cardiovascular research, where proteome-wide association studies were integrated with genomic data using Mendelian Randomization to identify and validate potential drug targets .

What statistical considerations are important when analyzing experimental data for C1orf185?

  • Experimental design considerations:

    • Power analysis to determine sample size

    • Randomization to avoid batch effects

    • Blinding where appropriate to prevent bias

    • Appropriate controls (positive, negative, vehicle)

  • Statistical test selection:

    • Match test to data distribution and experimental design

    • Consider parametric vs. non-parametric options

    • Account for repeated measures or nested designs

    • Use appropriate post-hoc tests for multiple comparisons

  • Multiple testing correction:

    • Bonferroni correction for strict family-wise error rate control

    • Benjamini-Hochberg procedure for false discovery rate control

    • Consider genome-wide significance thresholds (p < 5 × 10^-8) for high-dimensional data

  • Reporting requirements:

    • Effect sizes and confidence intervals, not just p-values

    • Detailed methods for reproducibility

    • Raw data availability when possible

    • Clear visualization of data distribution

  • Advanced considerations:

    • Batch effect correction methods

    • Missing data handling strategies

    • Outlier identification and treatment

    • Appropriate normalization methods

These statistical considerations align with approaches used in genome-wide association studies and proteomics research, ensuring robust and reproducible findings .

How can pathway analysis enhance understanding of C1orf185 function?

Pathway analysis places protein function in biological context:

  • Pathway enrichment approaches:

    • Over-representation analysis of interaction partners

    • Gene set enrichment analysis of expression changes upon perturbation

    • Functional class scoring methods

    • Topology-based pathway analysis using protein interaction networks

  • Biological databases to leverage:

    • KEGG for metabolic and signaling pathways

    • Reactome for detailed reaction pathways

    • Gene Ontology for functional classification

    • STRING and BioGRID for interaction networks

  • C1orf185-specific approach:

    • Analyze pathways enriched among interaction partners

    • Examine pathways altered in expression studies

    • Compare with pathways containing homologous proteins

    • Identify pathways co-expressed with C1orf185

  • Visualization and interpretation:

    • Network visualization tools (Cytoscape, STRING)

    • Pathway visualization (PathVisio, KEGG mapper)

    • Hierarchical clustering of pathway associations

    • Cross-species pathway conservation analysis

Pathway analysis has been successfully applied to uncharacterized proteins in bacterial systems, helping to identify potential roles in virulence, antibiotic resistance, and metabolism . Similar approaches could reveal the biological context of C1orf185 function.

What are the most promising research directions for C1orf185 characterization?

A strategic research roadmap should prioritize key questions in a logical sequence:

  • Foundational characterization:

    • Confirm and refine subcellular localization

    • Determine tissue and cell type-specific expression patterns

    • Establish membrane topology if transmembrane domains are confirmed

    • Develop well-validated research tools (antibodies, expression constructs)

  • Functional investigations:

    • Identify and validate protein interaction partners

    • Perform phenotypic analysis of knockout/knockdown models

    • Investigate post-translational modifications and their functional significance

    • Determine three-dimensional structure or structural domains

  • Physiological and pathological relevance:

    • Analyze expression in disease states

    • Investigate genetic variants and their functional impact

    • Develop animal models for in vivo functional studies

    • Explore potential as a biomarker or therapeutic target

  • Integration with existing knowledge:

    • Place findings in the context of known biological pathways

    • Compare with other uncharacterized proteins for potential functional relationships

    • Develop comprehensive models of function integrating all data types

These research directions mirror successful approaches used to characterize hypothetical proteins in other systems, where integration of computational prediction with experimental validation has led to functional insights and potential applications .

How can researchers effectively document and share C1orf185 research findings?

Knowledge sharing accelerates scientific progress:

  • Publication strategies:

    • Consider preprint servers for rapid dissemination

    • Target appropriate journals based on research focus

    • Include comprehensive methods sections for reproducibility

    • Share negative results to prevent duplication of unsuccessful approaches

  • Data sharing practices:

    • Deposit raw data in appropriate repositories:

      • Proteomics data in ProteomeXchange/PRIDE

      • Genomics data in SRA/ENA

      • Structural data in PDB/EMDB

    • Share research protocols on platforms like protocols.io

    • Consider open notebook science for ongoing research

  • Resource development:

    • Generate and share research tools (antibodies, constructs, cell lines)

    • Develop online resources for C1orf185 research community

    • Update protein databases with new findings

    • Contribute to functional annotation efforts

  • Collaborative approaches:

    • Form interdisciplinary collaborations to address complex questions

    • Participate in protein function annotation initiatives

    • Consider crowd-sourcing approaches for challenging problems

    • Engage with clinical researchers for translational potential

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.