Recombinant Human Uncharacterized protein C1orf43 (C1orf43)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
C1orf43; NICE3; NS5ATP4; HSPC012; Protein C1orf43; Hepatitis C virus NS5A-transactivated protein 4; HCV NS5A-transactivated protein 4; Protein NICE-3; S863-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
C1orf43
Target Protein Sequence
MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRGPHVPVGHNAPKDLKE EIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQSCYNYLYRMKALDAIRTSEIPFHSE GRHPRSLMGKNFRSYLLDLRNTSTPFKGVRKALIDTLLDGYETARYGTGVFGQNEYLRYQ EALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQKSKRAKHFLELK SFKDNYNTLESTL
Uniprot No.

Target Background

Function
C1orf43 is a general regulator of phagocytosis, essential for the uptake of Gram-negative bacteria by macrophages.
Gene References Into Functions
  1. Research suggests that C1orf43 may contribute to hepatocellular carcinoma by promoting cell proliferation. PMID: 23167344
Database Links

HGNC: 29876

OMIM: 617428

KEGG: hsa:25912

STRING: 9606.ENSP00000357507

UniGene: Hs.287471

Subcellular Location
Membrane; Single-pass membrane protein. Golgi apparatus. Mitochondrion.

Q&A

What is C1orf43 and where is it located in the human genome?

C1orf43 (chromosome 1 open reading frame 43) is a protein-coding gene located on chromosome 1 at position 1q21.3. The genomic sequence spans from position 154206720 to 154220590 on the complement strand (NC_000001.11). The gene consists of 7 exons and encodes a protein that is involved in phagocytosis. C1orf43 is also known by several alternative names including NICE3, NICE-3, S863-3, HSPC012, and NS5ATP4 .

What are the subcellular localization patterns of C1orf43?

C1orf43 protein is primarily located in three subcellular compartments: the Golgi apparatus, cytosol, and mitochondrion. This multi-compartmental distribution suggests diverse functional roles within the cell, with its most documented function being regulation of phagocytosis . Experimental approaches to confirm this localization include immunofluorescence microscopy with compartment-specific markers and subcellular fractionation followed by Western blotting.

What expression systems are most suitable for producing recombinant C1orf43?

Based on the literature, E. coli is the predominant expression system used for recombinant C1orf43 production. Specifically, full-length human C1orf43 protein (1-253 amino acids) is typically expressed with an N-terminal His-tag for purification purposes . For researchers developing expression protocols, consider:

  • The codon usage optimization for E. coli, especially since human proteins may contain codons that are rare in E. coli

  • The selection of appropriate vectors (pET series vectors are commonly used)

  • The use of specialized E. coli strains designed for recombinant protein expression (BL21(DE3), Rosetta, etc.)

For membrane-associated proteins like C1orf43 which contains hydrophobic regions, expression in E. coli may result in inclusion bodies formation, requiring refolding procedures .

How can I optimize the expression of recombinant C1orf43 in E. coli?

Optimization of C1orf43 expression in E. coli can be approached through several strategies:

  • Transcription-translation coupling modification: Research has shown that manipulating the kinetics of transcription and translation by modifying promoter strength and ribosome binding sites can significantly affect protein yields. For instance, using weaker variants of strong promoters like P70a and ribosome binding sites like UTR1 can counterintuitively increase protein expression by reducing ribosome traffic jams and transcription-translation coupling issues .

  • Strategic codon usage modification: Introducing specific slow-translating codons at strategic positions, particularly in the early portion of the gene (first 37 codons), can function as "traffic lights" that reduce ribosomal density downstream and prevent detrimental interactions between translation apparatus (DITA) .

  • Deletion of flagella regulator genes: Knocking out the flagella master regulator FlhC has been shown to increase ATP levels and NADPH/NADP+ ratio, redirecting metabolic flux toward the pentose phosphate and TCA cycle pathways. This approach led to a 1.81-fold increase in recombinant protein yield per glucose consumption in one study .

A systematic approach testing different combinations of these strategies is recommended for maximizing C1orf43 expression.

What purification methods yield the highest purity for recombinant C1orf43?

For His-tagged recombinant C1orf43, immobilized metal affinity chromatography (IMAC) is the primary purification method. To achieve >90% purity as reported in commercial preparations , a multi-step purification protocol is recommended:

  • Initial IMAC purification: Using Ni-NTA or Co-NTA resin with a gradient elution of imidazole (20-250 mM)

  • Size exclusion chromatography (SEC): To remove aggregates and further increase purity

  • Quality control analysis: SDS-PAGE followed by Coomassie staining to confirm purity (>90%)

The final purified protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage .

What is the biological function of C1orf43, and how can it be experimentally verified?

C1orf43 functions as a general regulator of phagocytosis, specifically required for the uptake of Gram-negative bacteria by macrophages . To experimentally verify this function, researchers can employ several approaches:

  • Genetic knockdown/knockout studies: Using siRNA, CRISPR-Cas9, or other gene editing techniques to reduce or eliminate C1orf43 expression in macrophage cell lines or primary cells, followed by phagocytosis assays using fluorescently labeled bacteria or beads

  • Complementation assays: Restoring C1orf43 expression in knockout cells to confirm that the observed phenotype is specifically due to loss of C1orf43

  • Interaction studies: Identifying protein binding partners through co-immunoprecipitation, yeast two-hybrid, or proximity labeling approaches to understand the molecular mechanisms of C1orf43 function

  • Live cell imaging: Tracking fluorescently tagged C1orf43 during phagocytosis to observe its dynamic localization and potential recruitment to phagocytic cups or phagosomes

These functional studies would provide insights into the specific role of C1orf43 in phagocytosis regulation .

What experimental design is most appropriate for studying C1orf43 function in vitro?

When designing experiments to study C1orf43 function in vitro, consider implementing:

  • Cell model selection: Since C1orf43 is involved in phagocytosis, primary macrophages or macrophage cell lines (THP-1, RAW264.7) are appropriate models. For general cellular functions, HEK293 or HeLa cells may be suitable.

  • Expression manipulation strategies:

    • Overexpression: Transfection with C1orf43 expression vectors (with fluorescent or epitope tags)

    • Knockdown: siRNA or shRNA targeting C1orf43

    • Knockout: CRISPR-Cas9 gene editing

    • Domain mapping: Expression of truncated variants to identify functional domains

  • Functional readouts:

    • Phagocytosis assays using fluorescent beads or labeled bacteria

    • Subcellular localization using confocal microscopy

    • Protein-protein interaction studies (co-IP, proximity labeling)

    • Transcriptomic analysis to identify downstream effects

For robust experimental design, include appropriate controls and perform statistical analysis as outlined in experimental design guides . Additionally, consider quasi-experimental designs when randomization is not possible or ethical .

How should I design experiments to optimize recombinant C1orf43 production?

For systematic optimization of recombinant C1orf43 production, a factorial experimental design is recommended to test multiple variables simultaneously:

  • Strain selection: Compare standard BL21(DE3) with specialized strains like Rosetta (for rare codon usage) or SHuffle (for disulfide bond formation)

  • Expression vector optimization:

    • Test different strength promoters (T7, tac, P70a, P70b)

    • Evaluate different ribosome binding sites (UTR1, UTR3)

    • Compare N-terminal vs. C-terminal His-tags

  • Induction conditions matrix:

    IPTG ConcentrationTemperatureDurationOD600 at Induction
    0.1 mM16°C18h0.6
    0.5 mM25°C6h0.8
    1.0 mM37°C3h1.0
  • Genetic modifications:

    • Introduction of slow-translating codons at strategic positions

    • FlhC knockout to redirect cellular energy

    • Combination of modifications

  • Analysis of results:

    • Quantify protein yield (mg/L culture)

    • Assess solubility (% soluble vs. insoluble)

    • Measure purity after standard purification

    • Evaluate biological activity

Statistical analysis of these factorial experiments will identify optimal conditions and potential interaction effects between variables.

What controls are essential when studying C1orf43 using antibody-based techniques?

When employing antibody-based techniques to study C1orf43, the following controls are critical for ensuring reliable results:

  • Antibody validation controls:

    • Positive control: Lysate from cells overexpressing C1orf43

    • Negative control: Lysate from C1orf43 knockout cells

    • Peptide blocking: Pre-incubation of antibody with recombinant C1orf43 (aa 39-113) control fragment at 100x molar excess to confirm specificity

  • Immunoprecipitation controls:

    • Input sample: Total lysate before IP

    • IgG control: Non-specific IgG from the same species as the C1orf43 antibody

    • Reverse IP: IP with antibodies against suspected interacting partners

  • Immunofluorescence controls:

    • Secondary antibody only

    • Peptide competition

    • siRNA knockdown to confirm signal reduction

  • Western blot controls:

    • Molecular weight marker

    • Positive and negative controls as described above

    • Loading control (GAPDH, β-actin, etc.)

These controls ensure that observed signals are specific to C1orf43 and not artifacts of the technique or antibody cross-reactivity.

How can I address low yield issues when expressing recombinant C1orf43?

Low yield of recombinant C1orf43 can be addressed through a systematic troubleshooting approach:

  • Diagnosis of bottlenecks:

    • Check mRNA levels via RT-qPCR to confirm transcription

    • Analyze whole cell lysates on SDS-PAGE to determine if protein is being expressed but insoluble

    • Examine for potential protein degradation products

  • Transcription-translation coupling optimization:

    • Implement the counterintuitive approach of using weaker promoters (e.g., P70b instead of P70a) and weaker ribosome binding sites (e.g., UTR3 instead of UTR1) to reduce ribosomal traffic jams and prevent detrimental interactions between the translation apparatus (DITA)

    • Introduce early UAG codons or slow-translating codons in the first 37 positions to serve as "traffic lights" that reduce ribosomal density downstream

  • Metabolic engineering approaches:

    • Consider knocking out the flagella regulator gene flhC, which has been shown to increase ATP levels and NADPH/NADP+ ratio, redirecting metabolic flux toward protein production

    • Combine with ptsG deletion to further enhance metabolic redirection

  • Culture condition optimization:

    • Lower induction temperature (16-25°C)

    • Reduce IPTG concentration (0.1-0.5 mM)

    • Add compatible solutes (sorbitol, glycine betaine)

    • Test auto-induction media

This multi-faceted approach addresses the complex interplay of factors affecting recombinant protein expression.

What are the common sources of variability in C1orf43 functional assays, and how can they be controlled?

Functional assays for C1orf43, particularly those related to phagocytosis, can exhibit considerable variability. Key sources and control strategies include:

  • Cell heterogeneity issues:

    • Use clonal cell populations when possible

    • Ensure consistent cell passage number and density

    • Standardize cell activation state for macrophages

  • Target particle variability (for phagocytosis assays):

    • Use synthetic particles (e.g., latex beads) with defined size and surface properties

    • For bacterial targets, standardize culture conditions and opsonization

    • Employ fluorescently labeled targets with consistent labeling efficiency

  • Quantification method variability:

    • Develop clear criteria for counting phagocytosed particles

    • Use automated image analysis where possible

    • Include calibration standards in flow cytometry assays

  • Experimental design controls:

    • Include positive controls (known enhancers of phagocytosis)

    • Use negative controls (cytochalasin D to block actin-dependent phagocytosis)

    • Implement technical and biological replicates

  • Statistical approach:

    • Power analysis to determine appropriate sample size

    • Use appropriate statistical tests based on data distribution

    • Control for multiple comparisons

A well-designed experimental protocol addressing these sources of variability will produce more reliable and reproducible results when studying C1orf43 function.

How can I achieve better solubility of recombinant C1orf43 protein?

Improving solubility of recombinant C1orf43, which contains hydrophobic regions that may contribute to aggregation, can be approached through several strategies:

  • Expression condition modifications:

    • Lower temperature cultivation (16-20°C)

    • Reduced inducer concentration

    • Co-expression with molecular chaperones (GroEL/ES, DnaK/DnaJ/GrpE)

  • Construct design optimization:

    • Express soluble domains identified through bioinformatic analysis

    • Create fusion proteins with solubility enhancers (MBP, SUMO, GST, Thioredoxin)

    • Test different linker sequences between the tag and C1orf43

  • Buffer optimization during purification:

    • Screen different pH values (typically pH 7.0-8.5)

    • Test various ionic strengths (100-500 mM NaCl)

    • Include mild detergents (0.05-0.1% Triton X-100, NP-40, or DDM)

    • Add stabilizing agents (5-10% glycerol, 1-5 mM DTT or β-mercaptoethanol)

  • Refolding protocols (if inclusion bodies are inevitable):

    • Solubilize inclusion bodies with 6-8 M urea or guanidine-HCl

    • Remove denaturant through dialysis, dilution, or on-column refolding

    • Include appropriate redox agents to enable proper disulfide bond formation

  • Storage optimization:

    • Store at -20°C/-80°C in buffer containing 50% glycerol

    • Aliquot to avoid repeated freeze-thaw cycles

    • Consider lyophilization with cryoprotectants

Systematic testing of these approaches, potentially using a Design of Experiments (DoE) framework, can identify optimal conditions for soluble C1orf43 production.

How might genetic variants in C1orf43 impact its function, and how can this be studied?

Investigating the impact of genetic variants in C1orf43 requires a multi-layered approach:

  • Identification of relevant variants:

    • Analyze population genomics databases (gnomAD, 1000 Genomes)

    • Examine disease-associated variants from ClinVar and GWAS studies

    • Focus on variants in highly conserved regions or functional domains

  • Computational prediction of variant effects:

    • Use tools like SIFT, PolyPhen, and CADD to predict functional impact

    • Employ protein modeling to assess structural consequences

    • Analyze potential effects on splicing or expression through tools like SpliceAI

  • Experimental validation approaches:

    • Site-directed mutagenesis to generate variant forms

    • Expression in knockout cell lines to assess functional rescue

    • Comparative biochemical characterization (stability, interaction partners)

  • High-throughput variant analysis:

    • Develop multiplex assays to test multiple variants simultaneously

    • Consider deep mutational scanning approaches

    • Implement CRISPR base editing for endogenous variant generation

  • Linkage disequilibrium considerations:

    • Analyze LD blocks containing C1orf43 to identify co-inherited variants

    • Design experiments accounting for statistical power needed to detect small-effect variants, as Bayes factor calculations suggest large sample sizes are required for reliable detection of small-effect variants

This comprehensive approach would provide insights into how genetic variation in C1orf43 might contribute to functional differences or disease susceptibility.

What multi-omics approaches can be used to better understand C1orf43's role in cellular pathways?

To comprehensively investigate C1orf43's role in cellular pathways, several multi-omics approaches can be integrated:

  • Transcriptomics strategies:

    • RNA-seq after C1orf43 knockout/knockdown to identify differentially expressed genes

    • Single-cell RNA-seq to capture cell-specific responses

    • TIME-seq for temporal transcriptional changes following C1orf43 manipulation

  • Proteomics approaches:

    • Quantitative proteomics comparing wild-type and C1orf43-deficient cells

    • Proximity labeling (BioID, APEX) to identify the C1orf43 interactome

    • Phosphoproteomics to identify signaling pathways affected

  • Genomics integration:

    • ChIP-seq to identify potential transcriptional regulation

    • ATAC-seq to assess chromatin accessibility changes

    • Analysis of eQTLs and sQTLs that might affect C1orf43 expression or splicing

  • Metabolomics complementation:

    • Targeted metabolomics focusing on pathways related to phagocytosis

    • Stable isotope labeling to track metabolic flux changes

  • Advanced integration methods:

    • Apply multivariate rank-distance correlation approaches like MrDcGene to integrate multiple data types

    • Implement network-based analyses to position C1orf43 within cellular pathway architecture

    • Develop causal inference models to distinguish direct from indirect effects

This multi-omics strategy would provide a systems-level understanding of C1orf43 function beyond its known role in phagocytosis.

What novel experimental techniques could advance our understanding of C1orf43 dynamics and interactions in living cells?

Cutting-edge techniques to investigate C1orf43 dynamics and interactions in living cells include:

  • Advanced live-cell imaging approaches:

    • Super-resolution microscopy (PALM/STORM/STED) to visualize C1orf43 beyond the diffraction limit

    • Lattice light-sheet microscopy for extended 3D imaging with reduced phototoxicity

    • Single-molecule tracking to follow individual C1orf43 proteins during phagocytosis

  • Proximity-based interaction mapping:

    • Split fluorescent protein complementation to visualize protein interactions in real-time

    • FRET/FLIM to measure nanoscale interactions between C1orf43 and potential partners

    • TurboID or miniTurbo proximity labeling for rapid (~10 min) interactome mapping

  • Optogenetic and chemogenetic control:

    • Light-inducible clustering or degradation of C1orf43 to study temporal aspects of function

    • Small molecule-induced protein destabilization for rapid functional perturbation

    • Optogenetic recruitment to specific cellular compartments to test location-specific functions

  • CRISPR-based technologies:

    • CRISPRa/CRISPRi for endogenous gene modulation rather than complete knockout

    • CRISPR lineage tracing to study cell population dynamics influenced by C1orf43

    • CRISPR screening with focused libraries to identify genetic modifiers of C1orf43 function

  • Biomolecular condensate analysis:

    • Investigation of potential phase separation properties of C1orf43

    • Analysis of C1orf43 recruitment to known condensates during cellular stress or phagocytosis

    • Optogenetic control of condensate formation to test functional consequences

These cutting-edge approaches would provide unprecedented insights into C1orf43's dynamic behavior and interactions in the cellular context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.