Recombinant Human Uncharacterized protein C22orf24 (C22orf24)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us; we will prioritize its development.
Synonyms
YWHAH-AS1; C22orf24; Putative uncharacterized protein YWHAH-AS1; YWHAH antisense RNA 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
C22orf24
Target Protein Sequence
MTTQEDTTGLHQKTSLWTMSRPGAKKVMNSYFIAGCGPAVCYYAVSWLRQGFSINLTSFG RIPWPHAGVGTCPSPQSWISPFLQSHREHHYAKTSSHSQPSPQSLALCLAYSRCSINICQ MTECISLASGCHQALREPGRSEESFWIPATPYISNIFSES
Uniprot No.

Target Background

Database Links

HGNC: 23051

KEGG: hsa:25775

UniGene: Hs.627602

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the basic characteristics of Human C22orf24?

Human C22orf24 is a protein-coding gene located on chromosome 22. The protein is currently classified as "uncharacterized," indicating limited knowledge about its structure and function. According to database information, C22orf24 has homologs in other species, including cheetah (Acinonyx jubatus) . The protein has been cataloged in target databases such as Pharos, where it is classified as a target with minimal known information regarding drug interactions or small molecule activities .

Current knowledge metrics for C22orf24:

Knowledge CategoryKnowledge Value (0 to 1 scale)
Histone modification site profile0.79
microRNA0.65
PubMedID0.58
Cell type or tissue0.56
Transcription factor binding site profile0.55

What expression systems are recommended for producing recombinant C22orf24?

For recombinant production of uncharacterized proteins like C22orf24, several expression systems can be considered:

  • Bacterial Expression (E. coli): Most cost-effective and rapid system. For C22orf24, consider using strains designed for improved disulfide bond formation, such as Origami 2 (trxB-/gor-), which provides an oxidizing environment that may help with proper protein folding .

  • Mammalian Expression Systems: Though more expensive, these may provide better post-translational modifications. For membrane-associated or complex proteins, this system often yields more functionally relevant proteins.

  • Yeast Expression Systems: Offers a compromise between bacterial and mammalian systems with moderately complex post-translational modifications.

The optimal choice depends on your experimental goals:

Expression SystemAdvantagesDisadvantagesRecommendation for C22orf24
E. coliHigh yield, low cost, rapid expressionLimited post-translational modifications, potential inclusion body formationUse BL21 or Origami 2 strains with temperature optimization (22°C expression after induction)
MammalianNative-like post-translational modificationsHigher cost, longer production timeConsider if initial characterization suggests complex structure or modifications
YeastModerate post-translational capabilities, good yieldMedium complexity of setupGood alternative if bacterial expression fails

How should I design expression constructs for C22orf24?

When designing expression constructs for an uncharacterized protein like C22orf24, consider:

  • Vector selection: For initial characterization, vectors with strong promoters like pET series (for bacterial expression) are recommended. Based on search results, pET28 vectors with N- and C-terminal His-tags have been successfully used for other recombinant proteins .

  • Affinity tags: Include purification tags that can be cleaved if necessary. A dual-tagging approach may be beneficial:

    • N-terminal: His-tag for purification

    • C-terminal: Additional tag (e.g., T7-tag) for detection

  • Promoter considerations: For bacterial expression, T7 promoter systems offer strong inducible expression. For mammalian systems, CMV promoters provide strong constitutive expression.

  • Codon optimization: Ensure codon optimization for your expression host to maximize protein production.

  • Signal sequences: Consider including secretion signals (like phoA sequence for E. coli) if secretion is desired .

What initial characterization methods should be applied to recombinant C22orf24?

For basic characterization of recombinant C22orf24:

  • SDS-PAGE and Western blotting: Confirm expression and approximate molecular weight.

  • Mass spectrometry: Verify protein identity and potential post-translational modifications.

  • Circular dichroism (CD): Assess secondary structure elements.

  • Size exclusion chromatography: Determine oligomeric state and homogeneity.

  • Preliminary localization studies: Use fluorescent tags or immunostaining to determine cellular localization, which may provide functional insights.

  • Bioinformatic analysis: Compare sequence with characterized proteins to predict potential functions, domains, or structural motifs.

How can I determine the biological function of C22orf24 using transcriptomic approaches?

Transcriptomic approaches can provide valuable insights into the function of uncharacterized proteins like C22orf24:

  • RNA-Seq analysis under various conditions: Compare gene expression profiles between control and C22orf24 overexpression or knockdown conditions.

  • Pathway enrichment analysis: From the transcriptome data, conduct functional enrichment analysis to identify pathways potentially associated with C22orf24.

A robust methodology based on recent literature would include:

  • Generate expression constructs for C22orf24 overexpression or knockdown systems

  • Perform RNA extraction with stringent quality control (ensure RIN values >8)

  • Conduct RNA-Seq with sufficient depth (>30 million reads per sample)

  • Normalize expression data using FPKM method

  • Identify differentially expressed genes (DEGs) using statistical thresholds (p<0.05, |log2FC|>1)

  • Perform functional enrichment analysis using databases like Reactome Pathways and Gene Ontology

Recent studies employing similar approaches for other proteins have revealed complex regulatory networks. For example, a 2025 study analyzing abdominal aortic aneurysm identified 6,572 differentially expressed genes, with 4,035 up-regulated and 2,538 down-regulated genes, leading to functional insights into previously unknown mechanisms .

What strategies can I use to identify interaction partners of C22orf24?

For identifying protein-protein interactions of uncharacterized proteins like C22orf24:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged C22orf24 in relevant cell lines

    • Perform pull-down assays using the tag

    • Identify co-precipitated proteins by mass spectrometry

    • Validate key interactions with co-immunoprecipitation and Western blotting

  • Proximity labeling methods:

    • BioID or APEX2 fusion proteins to identify proteins in close proximity to C22orf24

    • These methods can identify transient or weak interactions difficult to capture with traditional AP-MS

  • Yeast two-hybrid screening:

    • Although prone to false positives, can provide complementary data to AP-MS approaches

The methodology described in study for analyzing protein-protein interaction networks could be adapted:

  • Construct a co-expression matrix with Pearson correlation coefficient thresholds (|r|>0.9)

  • Use validated interaction partners to perform functional enrichment studies

  • Visualize protein-protein interaction networks using tools like Cytoscape

How can I assess the subcellular localization and trafficking of C22orf24?

For determining subcellular localization of C22orf24:

  • Fluorescent protein fusion constructs:

    • Create C-terminal and N-terminal GFP (or other fluorescent protein) fusions

    • Express in relevant cell lines

    • Analyze by confocal microscopy

    • Co-localize with known organelle markers

  • Immunofluorescence with organelle markers:

    • Develop specific antibodies against C22orf24 if not commercially available

    • Perform co-localization studies with established organelle markers

  • Subcellular fractionation coupled with Western blotting:

    • Isolate cellular compartments (nucleus, cytoplasm, mitochondria, etc.)

    • Analyze presence of C22orf24 in each fraction

    • Compare with known compartment markers

  • Live-cell imaging for trafficking studies:

    • Time-lapse confocal microscopy of fluorescently tagged C22orf24

    • Photoactivatable or photoconvertible tags for pulse-chase experiments

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility assessment

Research approaches similar to those described in search result might be valuable, where advanced microscopic techniques were employed to study protein localization and function in neuronal tissues.

What are effective strategies for studying the structure-function relationship of C22orf24?

Given the uncharacterized nature of C22orf24, a systematic approach to structure-function analysis is recommended:

  • In silico structural prediction:

    • Use AlphaFold2 or similar AI-based structure prediction tools

    • Identify potential functional domains through homology searches

    • Predict protein-protein interaction interfaces

    • Model potential ligand binding sites

  • Directed mutagenesis:

    • Based on structural predictions, design mutations of key residues

    • Focus on highly conserved residues across species

    • Create a panel of mutants targeting different predicted functional domains

  • Functional assays:

    • Develop assays based on predicted functions or observed phenotypes

    • Compare wild-type and mutant proteins in these assays

    • Correlate structural features with functional outcomes

  • Structural studies:

    • X-ray crystallography or Cryo-EM for high-resolution structure

    • NMR for dynamic regions or smaller domains

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational dynamics

This comprehensive approach allows for iterative refinement of structural and functional understanding.

How can I investigate the potential role of C22orf24 in disease pathways?

To explore potential disease associations for an uncharacterized protein like C22orf24:

  • Genetic association studies:

    • Analyze GWAS data for SNPs in or near the C22orf24 gene

    • Investigate potential links to disease phenotypes

  • Expression analysis in disease tissues:

    • Compare C22orf24 expression between normal and disease tissues

    • Use public databases (TCGA, GTEx) and perform validation in independent cohorts

  • Functional studies in disease models:

    • Create cell or animal models with C22orf24 overexpression or knockdown

    • Assess effects on disease-relevant phenotypes

  • Multi-omics integration:

    • Apply deep learning approaches similar to those described in search result

    • Use frameworks like multi-omics variational autoencoders (MOVE) to identify associations between C22orf24 and disease pathways

A 2025 study demonstrated how multi-modal data integration can reveal drug-omics associations in type 2 diabetes . Similar approaches could uncover potential roles of C22orf24 in disease processes.

What are the best approaches for developing and validating antibodies against C22orf24?

Developing specific antibodies for uncharacterized proteins presents unique challenges:

  • Epitope selection:

    • Perform bioinformatic analysis to identify unique, accessible epitopes

    • Consider both linear and conformational epitopes

    • Generate synthetic peptides for immunization or recombinant protein fragments

  • Antibody production methods:

    • Polyclonal antibodies: Faster development but lower specificity

    • Monoclonal antibodies: Higher specificity but more resource-intensive

    • Recombinant antibodies: Offers reproducibility and defined specificity

  • Comprehensive validation protocol:

    Validation MethodPurposeAcceptance Criteria
    Western blotConfirm specific binding and apparent molecular weightSingle band at expected molecular weight
    ImmunoprecipitationVerify ability to capture native proteinEnrichment of target in IP vs. control
    ImmunocytochemistryAssess subcellular localizationSpecific staining pattern consistent with other localization methods
    Knockout/knockdown controlsConfirm specificityReduced or absent signal in cells lacking C22orf24
    Cross-reactivity testingEvaluate specificity across speciesConsistent reactivity with orthologous proteins if claimed
  • Documentation and transparency:

    • Document all validation steps thoroughly

    • Report all experimental conditions and limitations

    • Consider contributing to antibody validation databases

How should I design experiments to identify potential post-translational modifications of C22orf24?

For investigating post-translational modifications (PTMs) of C22orf24:

  • Mass spectrometry-based approaches:

    • Enrich for C22orf24 using immunoprecipitation or affinity purification

    • Perform tryptic digestion followed by LC-MS/MS analysis

    • Use multiple proteases for improved sequence coverage

    • Consider enrichment methods for specific PTMs (e.g., phosphopeptide enrichment, glycopeptide enrichment)

  • Site-directed mutagenesis validation:

    • Mutate identified PTM sites to non-modifiable residues

    • Assess functional consequences of these mutations

    • Compare wild-type and mutant proteins for differences in localization, interaction partners, or stability

  • Temporal dynamics of PTMs:

    • Analyze PTMs under different cellular conditions (stress, differentiation, cell cycle phases)

    • Perform pulse-chase experiments to assess PTM turnover

  • Correlation with function:

    • Develop functional assays based on predicted roles

    • Compare activities of modified and unmodified forms

Knowledge about histone modification site profiles appears to be the most well-established aspect of C22orf24 (knowledge value 0.79 on a 0-1 scale) , suggesting that epigenetic regulation might be a productive area for investigation.

What are the considerations for developing C22orf24 knockdown or knockout models?

For generating C22orf24 depletion models:

  • RNAi-based knockdown:

    • Design multiple siRNA or shRNA constructs targeting different regions

    • Validate knockdown efficiency by qRT-PCR and Western blot

    • Include scrambled control sequences

    • Consider inducible knockdown systems for temporal control

  • CRISPR-Cas9 knockout strategies:

    • Design sgRNAs with minimal off-target effects

    • Create complete knockouts or specific domain deletions

    • Validate edits by sequencing and protein expression analysis

    • Generate homozygous and heterozygous models to assess gene dosage effects

  • Phenotypic characterization:

    • Perform comprehensive phenotyping including:

      • Proliferation and viability assays

      • Morphological analysis

      • Transcriptome profiling

      • Proteome analysis

      • Functional assays based on predicted functions

Similar genome-wide RNA interference screening approaches have successfully identified host factors in viral propagation, as described in search result , which could serve as a methodological template.

How can I investigate if C22orf24 has tissue-specific expression or functions?

To explore tissue specificity of C22orf24:

  • Expression analysis across tissues:

    • Analyze public databases (GTEx, Human Protein Atlas) for baseline expression patterns

    • Perform qRT-PCR panel analysis across multiple tissues

    • Use Western blotting to confirm protein-level expression patterns

  • Single-cell RNA sequencing:

    • Analyze existing scRNA-seq datasets for cell-type specific expression

    • Perform targeted scRNA-seq on tissues of interest

    • Identify cell populations with high C22orf24 expression

  • Tissue-specific knockout models:

    • Generate conditional knockout animals using Cre-lox systems

    • Create tissue-specific promoter-driven expression constructs

    • Compare phenotypes across different tissue-specific models

  • Functional assays in tissue-relevant contexts:

    • Develop organ-on-chip or organoid models expressing or lacking C22orf24

    • Assess tissue-specific functions in these models

    • Compare interactomes across different tissue types

This multi-faceted approach can reveal whether C22orf24 has universal or tissue-specific roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.