Recombinant Human Uncharacterized protein C3orf45 (C3orf45)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
LSMEM2; C3orf45; Leucine-rich single-pass membrane protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-164
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LSMEM2
Target Protein Sequence
MPSLAPDCPLLAMPEETQEDSVAPMMPSQRSRGPLAPNHVHEVCLHQVESISDLHSGAGT LRPYLTEEARPWDELLGVLPPSLCAQAGCSPVYRRGGFLLLLALLVLTCLVLALLAVYLS VLQSESLRILAHTLRTQEETLLKLRLASLSQLRRLNSSEAQAPS
Uniprot No.

Target Background

Database Links

HGNC: 26781

KEGG: hsa:132228

UniGene: Hs.315177

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is recombinant human IL-34 and what is its biological significance?

Interleukin 34 (IL-34) is a secreted homodimer consisting of 39 kDa monomers that belongs to no known cytokine family. Human IL-34 is synthesized as a 242 amino acid precursor with a 20 amino acid signal sequence and a 222 amino acid mature chain. The protein contains one potential site of N-linked glycosylation and shares 71% identity with mouse IL-34 at the amino acid level. IL-34 is widely expressed in various tissues including heart, brain, liver, kidney, spleen, thymus, testes, ovary, small intestine, prostate, and colon, with highest abundance in the spleen. The protein signals through colony-stimulating factor 1 receptor (CSF-1R) and stimulates monocyte proliferation .

What formulation options are available for recombinant human IL-34?

Recombinant human IL-34 is available in two primary formulations:

  • With carrier protein (5265-IL): Lyophilized from a 0.2 μm filtered solution in PBS and NaCl with BSA as a carrier protein. This formulation enhances protein stability, increases shelf-life, and allows storage at more dilute concentrations .

  • Carrier-free (5265-IL/CF): Lyophilized from a 0.2 μm filtered solution in PBS and NaCl without BSA. This formulation is recommended for applications where BSA might interfere with experimental outcomes .

What are the recommended reconstitution protocols for recombinant IL-34?

For optimal results, follow these reconstitution protocols:

  • Standard formulation (5265-IL): Reconstitute at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin .

  • Carrier-free formulation (5265-IL/CF): Reconstitute at 100 μg/mL in sterile PBS .

For both formulations, it's recommended to use a manual defrost freezer and avoid repeated freeze-thaw cycles to maintain protein integrity and activity .

How should researchers design experiments to evaluate IL-34 biological activity?

When designing experiments to evaluate IL-34 biological activity, researchers should consider:

  • Dose determination: The effective dose (ED50) for IL-34-induced proliferation in human peripheral blood monocytes is 0.75-3.75 ng/mL. Design dose-response experiments within and beyond this range to establish the optimal concentration for your specific cell system .

  • Appropriate controls: Include both positive controls (known CSF-1R activators) and negative controls (vehicle only) to validate IL-34 activity.

  • Experimental approach selection: Consider implementing randomized controlled trial (RCT) designs when evaluating IL-34 effects, particularly when comparing multiple treatment conditions. Implementation-focused RCTs differ from traditional efficacy- or effectiveness-oriented RCTs on key parameters .

What experimental models are suitable for studying IL-34 functions?

Based on the literature, several experimental models have been successfully used to study IL-34 functions:

  • Human peripheral blood monocytes: Used to study proliferation responses and ERK1/2 phosphorylation .

  • Human bone marrow cultures: Employed to evaluate the formation of colony-forming unit-macrophage (CFU-M) .

  • Human iPSC-derived microglia-like cells: Used to study neuroinflammatory processes and microglial functions in disease contexts .

  • Human monocyte-derived macrophages: Applied to investigate IL-34-induced phenotypic changes and cytokine production .

When selecting an experimental model, researchers should consider the specific biological question being addressed and choose the most relevant cell type or system .

How can quasi-experimental designs be applied to IL-34 research?

For research questions where randomization is not feasible, quasi-experimental designs offer valuable alternatives:

  • Pre-post designs with non-equivalent control groups: Useful when studying IL-34 effects in naturally occurring populations or when randomization is ethically problematic. This approach compares outcomes before and after intervention while accounting for baseline differences between groups .

  • Interrupted time series (ITS): Appropriate for evaluating temporal effects of IL-34 treatments or interventions. This method involves collecting multiple observations before and after introducing IL-34, allowing researchers to distinguish between immediate effects and trends over time .

  • Stepped wedge designs: Beneficial when all participants must eventually receive IL-34 treatment but implementation needs to be staggered. This approach introduces the intervention to different groups at different timepoints, allowing for both between-group and within-group comparisons .

What analytical approaches are recommended for IL-34 signaling pathway studies?

When investigating IL-34 signaling pathways, consider these analytical approaches:

  • Phosphorylation analysis: IL-34 stimulates phosphorylation of extracellular signal-regulated kinase-1 and -2 (ERK1/2) in human monocytes, similar to CSF-1. Quantitative analysis of phosphorylation events can help elucidate downstream signaling mechanisms .

  • JAK/STAT pathway analysis: Evidence suggests IL-34 may signal through JAK3/STAT6 pathways in certain contexts, warranting investigation of these signaling components .

  • Comparative analysis with CSF-1: As both IL-34 and CSF-1 bind to CSF-1R, comparative studies of their signaling pathways can reveal unique and shared mechanisms of action .

How is IL-34 implicated in neurological disease research?

IL-34 has been studied in various neurological disease contexts:

  • Alzheimer's disease: Research indicates reduced levels of SH3RF3 may protect against Alzheimer's disease by lowering microglial pro-inflammatory responses via modulation of JNK and NFkB signaling, with IL-34 playing a role in this process .

  • Parkinson's disease: Studies have examined how α-synuclein assemblies combined with chronic-type inflammatory cues promote neurotoxic microglial phenotypes, with IL-34 being relevant to microglial activation states .

  • Nasu-Hakola disease: Research has investigated dynamic microglial dysfunction in this condition using IL-34-induced microglia-like cells derived from human monocytes .

What methodological considerations are important when studying IL-34 in infection and immunity?

When investigating IL-34 in infection and immunity contexts:

  • Viral infection models: Studies have shown IL-34 can inhibit hepatitis B virus replication in vitro and in vivo, suggesting specific methodological approaches for viral infection research .

  • T cell differentiation: IL-34 and M-CSF-induced macrophages can switch memory T cells into Th17 cells via membrane IL-1α, requiring careful experimental design to track cellular phenotypic changes .

  • Species-specific considerations: When designing experiments, consider species-specific differences in IL-34 activity. Human IL-34 shares only 71% amino acid identity with mouse IL-34, and studies have shown species specificity in stimulation by IL-34 across different species including feline models .

What statistical approaches are recommended for analyzing IL-34 experimental data?

When analyzing experimental data involving IL-34:

  • Define your methodological approach: Clearly articulate whether your research is quantitative, qualitative, or mixed-methods. This fundamental decision will guide your entire analytical framework .

  • Control for research biases: Implement appropriate controls and blinding procedures to minimize confirmation bias, especially when evaluating subjective outcomes in IL-34 experiments .

  • Justify analytical choices: Document why particular analytical methods were selected over alternatives, especially when dealing with complex datasets from IL-34 signaling studies .

  • Consider implementation science frameworks: For translational IL-34 research, implementation science approaches can help bridge the gap between basic research findings and clinical applications .

How should researchers address contradictory findings in IL-34 studies?

When confronting contradictory findings in IL-34 research:

  • Evaluate methodological differences: Carefully examine differences in experimental design, cell types, protein formulations, and analytical approaches that might explain divergent results .

  • Consider contextual factors: IL-34 functions may vary depending on cell type, tissue context, and disease state. What appears contradictory might reflect biological complexity rather than experimental error .

  • Implement replication studies: Design studies that specifically aim to replicate contradictory findings while controlling for key variables that might explain differences .

  • Meta-analytical approaches: When multiple studies show contradictory results, consider formal meta-analytical techniques to synthesize findings across studies and identify patterns that explain apparent contradictions .

What are the key ethical considerations for IL-34 research in human models?

Researchers working with IL-34 in human models should consider:

  • Source material ethics: When using human primary cells for IL-34 studies, ensure appropriate informed consent and ethical approval procedures are followed .

  • Translational implications: As IL-34 research may have implications for diseases like Alzheimer's, Parkinson's, and rheumatoid arthritis, consider the ethical implications of findings and how they are communicated .

  • Study design ethics: When implementing experimental or quasi-experimental designs, carefully weigh the ethical implications of control group selection and treatment allocation .

What are the best practices for long-term storage and stability of recombinant IL-34?

To maintain IL-34 stability and activity:

  • Storage conditions: Store reconstituted IL-34 at the recommended temperature. Use a manual defrost freezer and avoid repeated freeze-thaw cycles which can degrade protein activity .

  • Aliquoting strategy: Prepare single-use aliquots immediately after reconstitution to minimize freeze-thaw cycles .

  • Carrier protein considerations: For long-term storage of dilute solutions, consider using the formulation with carrier protein (BSA) as it enhances stability and increases shelf-life .

  • Quality control: Periodically verify protein activity through functional assays, such as monocyte proliferation tests, where the ED50 should be 0.75-3.75 ng/mL .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.