Recombinant Human Uncharacterized protein C4orf32 (C4orf32)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of the specified tag.
Synonyms
FAM241A; C4orf32; Uncharacterized protein FAM241A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
FAM241A
Target Protein Sequence
MCSAGELLRGGDGGERDEDGDALAEREAAGTGWDPGASPRRRGQRPKESEQDVEDSQNHT GEPVGDDYKKMGTLFGELNKNLINMGFTRMYFGERIVEPVIVIFFWVMLWFLGLQALGLV AVLCLVIIYVQQ
Uniprot No.

Target Background

Database Links

HGNC: 26813

KEGG: hsa:132720

STRING: 9606.ENSP00000310182

UniGene: Hs.23439

Protein Families
FAM241 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is C4orf32/FAM241A and where is it located in the human genome?

C4orf32, now officially designated as FAM241A (Family With Sequence Similarity 241 Member A), is a gene located on chromosome 4 at the 4q25 locus in humans. It resides between the PITX2 gene and a translational region that has been identified in genome-wide association studies as significantly associated with atrial fibrillation . The protein encoded by this gene remains largely uncharacterized, making it an intriguing target for fundamental research.

What are the known structural characteristics of C4orf32/FAM241A protein?

Based on proteomics studies, C4orf32/FAM241A appears to be a transmembrane protein associated with the endoplasmic reticulum (ER). The OpenCell project has revealed a high localization similarity between FAM241A and subunits of the ER oligo-saccharyl transferase (OST) complex, specifically STT3B and OSTC . This suggests a potential role in protein glycosylation or ER-related functions. The protein's structure includes transmembrane domains, though detailed three-dimensional structural information remains limited due to the absence of crystallography or cryo-EM studies.

What expression systems are most suitable for producing functional C4orf32/FAM241A?

Given FAM241A's likely role as an ER membrane protein potentially involved in glycosylation, several expression systems should be considered:

Expression SystemAdvantagesLimitationsRecommended Use
E. coliHigh yield, simplicity, low costLacks ER, post-translational modificationsSoluble domains only
Yeast (P. pastoris)Eukaryotic processing, moderate yieldLimited glycosylation patternsFull-length expression trials
Insect cells (Sf9/Hi5)Advanced folding machinery, good yieldMore complex than bacteria/yeastMembrane protein expression
Mammalian cells (HEK293)Native-like environment, proper glycosylationLower yields, higher costFunctional studies requiring authentic structure

For initial characterization studies, a system using mammalian cells with an N-terminal His-tag shows promise, similar to methods used for other uncharacterized proteins .

What methodologies have been used to study C4orf32/FAM241A function?

Several cutting-edge methodologies have been applied to begin characterizing FAM241A:

  • Proteome-scale endogenous tagging: The OpenCell approach used CRISPR-Cas9 technology to introduce fluorescent tags at the endogenous loci, allowing visualization of native expression and localization patterns .

  • Protein-protein interaction studies: Combined imaging with immunoprecipitation followed by mass spectrometry (IP-MS) to identify potential interaction partners .

  • Machine learning for localization pattern analysis: Encoding localization patterns using machine learning models revealed similarity to OST components without prior training with images of this target .

  • Genetic association studies: GWAS studies have identified the genomic locus containing C4orf32/FAM241A as associated with atrial fibrillation .

How can CRISPR-based approaches be utilized to study C4orf32/FAM241A function?

CRISPR technologies offer powerful tools for functional characterization:

CRISPR ApproachMethodologyApplication to C4orf32/FAM241A
Loss-of-function screensGenome-wide knockout librariesIdentify genes synthetically lethal with C4orf32/FAM241A knockout
CRISPRiTranscriptional repressionAssess phenotypic consequences of reduced expression in various cell types
CRISPRaTranscriptional activationEvaluate effects of overexpression on ER function and glycosylation
Endogenous taggingHDR-mediated knock-inStudy native localization and dynamics, as demonstrated in OpenCell
Base/prime editingPrecise nucleotide changesEvaluate effects of patient variants or structure-based mutations

CRISPR screens have proven valuable for identifying determinants of cellular responses in related contexts and could reveal C4orf32/FAM241A's functional network.

Is there evidence linking C4orf32/FAM241A to atrial fibrillation?

There is indirect evidence suggesting a potential link between C4orf32/FAM241A and atrial fibrillation (AF). Genome-wide association studies have identified the 4q25 locus, where C4orf32/FAM241A is located, as significantly associated with AF . This locus is positioned between the PITX2 gene and the translational region of C4orf32. While PITX2 has been more extensively studied in relation to AF, the proximity of C4orf32/FAM241A to this disease-associated locus suggests it may have relevance to cardiac electrical activity.

What approaches can be used to study the potential role of C4orf32/FAM241A in disease?

Several methodological approaches would be valuable:

  • Genetic association studies: Expanded GWAS or targeted sequencing of C4orf32/FAM241A in patient cohorts with atrial fibrillation or ER stress-related disorders.

  • CRISPR-based functional genomics: CRISPR screens can identify genes controlling cellular responses to various stimuli or treatments . Similar approaches could be applied to study C4orf32/FAM241A's role in disease-relevant phenotypes.

  • Multi-omics integration: Methods like DIABLO and NOLAS could help integrate transcriptomic, proteomic, and phenotypic data to understand C4orf32/FAM241A's role in disease contexts .

  • Patient-derived cellular models: Differentiation of patient-derived iPSCs (especially from individuals with variants in the 4q25 locus) into cardiomyocytes could enable functional studies in a disease-relevant context.

  • Scaffold-based tumor models: Methodologies using biomaterial scaffolds that capture metastatic tumor cells could be adapted to study C4orf32/FAM241A in the context of cancer biology .

What assays are appropriate for investigating C4orf32/FAM241A function?

Given the current understanding of C4orf32/FAM241A as potentially associated with the ER and OST complex, several assays would be appropriate:

Assay TypeMethodologyExpected Outcome
Protein glycosylation assaysMonitoring glycosylation status of reporter proteinsDetermine effects on N-linked glycosylation efficiency
ER stress response assaysMeasure UPR markers (XBP1 splicing, ATF6 cleavage)Reveal roles in ER homeostasis
Protein-protein interactionCo-IP, proximity labeling (BioID, APEX)Identify interaction partners, focusing on OST components
Subcellular localizationImmunofluorescence or live cell imagingConfirm ER localization and colocalization with OST components
Functional reconstitutionIn vitro assays with purified componentsTest specific biochemical activities
CRISPR-based phenotypic assaysKnockout/knockdown followed by cellular phenotypingIdentify pathway-level consequences of C4orf32/FAM241A disruption

How can recombinant C4orf32/FAM241A protein be efficiently expressed and purified?

Based on approaches used for similar uncharacterized proteins, a systematic strategy includes:

  • Construct design optimization:

    • Full-length construct with N-terminal His-tag

    • Domain-specific constructs excluding transmembrane regions

    • Fusion partners (MBP, GST) to improve solubility

  • Expression conditions:

    • Test multiple cell lines (HEK293, Expi293, CHO)

    • Optimize temperature (30-37°C) and induction time

    • Consider addition of chemical chaperones

  • Purification strategy:

    • IMAC (Ni-NTA) for initial capture

    • Size exclusion chromatography for further purification

    • For membrane-associated portions, include appropriate detergents (DDM, LMNG)

    • Buffer optimization with 30-50% glycerol for stability

  • Quality control:

    • SEC-MALS to assess oligomeric state

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to identify stabilizing conditions

What are the challenges in studying uncharacterized proteins like C4orf32/FAM241A?

Research on uncharacterized proteins presents several unique challenges:

  • Lack of functional context: Without established functions, designing appropriate assays is difficult. This necessitates unbiased screening approaches or computational predictions.

  • Limited reagent availability: Uncharacterized proteins typically lack validated antibodies or assay tools, requiring significant investment in reagent development.

  • Technical difficulties: Many uncharacterized proteins remain unstudied precisely because they pose challenges for expression or purification, often due to membrane association or aggregation tendency.

  • Publication challenges: Research on uncharacterized proteins may be perceived as riskier, making publication more difficult compared to studies of well-established proteins.

  • Functional redundancy: Some uncharacterized proteins may have redundant functions, making single-gene perturbation studies less informative without compound perturbations.

What multi-omics approaches are suitable for characterizing C4orf32/FAM241A function?

Multi-omics approaches can provide comprehensive insights by integrating multiple layers of biological information:

Omics ApproachMethodologyApplication to C4orf32/FAM241A
ProteomicsQuantitative proteomics comparing WT vs. knockoutIdentify affected proteins and pathways
GlycoproteomicsEnrichment and analysis of glycosylated proteinsDetermine effects on the glycoproteome
TranscriptomicsRNA-seq following C4orf32/FAM241A modulationIdentify transcriptional consequences
InteractomicsProximity labeling coupled with mass spectrometryDefine the C4orf32/FAM241A interactome
Structural proteomicsCrosslinking mass spectrometryMap interaction interfaces
Integrative analysisMethods like DIABLO and NOLAS Position C4orf32/FAM241A in cellular networks

How can protein-protein interaction studies enhance our understanding of C4orf32/FAM241A?

Protein-protein interaction studies are particularly valuable for uncharacterized proteins:

  • Proximity-based labeling: Methods like BioID or APEX, where C4orf32/FAM241A is fused to a proximity labeling enzyme, can identify proteins in its native microenvironment.

  • Correlation of spatial distributions: Quantitative comparison of spatial distribution patterns can predict protein-protein interactions with remarkable accuracy (>58% for high similarity pairs) .

  • Immunoprecipitation-mass spectrometry: As performed in the OpenCell project, IP-MS can identify stable interaction partners .

  • Crosslinking mass spectrometry: Chemical crosslinking followed by mass spectrometry can capture direct interactions and provide structural information about interaction interfaces.

  • Integrative structural biology: Combining multiple structural techniques (X-ray crystallography, cryo-EM, computational modeling) to characterize C4orf32/FAM241A complexes could provide detailed mechanistic insights.

The OpenCell study demonstrated that FAM241A has high localization similarity with STT3B and OSTC, suggesting it may interact with components of the ER oligo-saccharyl transferase complex . Further interaction studies focusing on these proteins would be particularly valuable.

How can machine learning approaches advance the functional characterization of C4orf32/FAM241A?

Machine learning offers powerful tools for uncharacterized protein analysis:

  • Localization pattern encoding: The OpenCell project demonstrated that encoding localization patterns using "naïve" machine learning models could successfully predict functional relationships between proteins, including FAM241A's association with the OST complex .

  • Protein function prediction: Deep learning models trained on protein sequences, structures, and interaction networks can predict potential functions for uncharacterized proteins.

  • Integration of multi-omics data: Machine learning algorithms can identify patterns across transcriptomic, proteomic, and phenotypic datasets to place C4orf32/FAM241A in functional networks.

  • Variant effect prediction: Deep learning models can predict the functional impact of genetic variants in C4orf32/FAM241A identified in patient populations.

  • Image analysis in high-content screening: Machine learning can identify subtle phenotypic changes in cells with C4orf32/FAM241A perturbations that might escape manual analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.