Recombinant Human Uncharacterized protein C4orf34 (C4orf34)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

  • Gene Location: Chromosome 4p14 (minus strand), spanning 92,567 base pairs with five exons .

  • Protein Features:

    • Size: 99 amino acids, single-pass transmembrane domain (TMD) .

    • Topology: Type I transmembrane protein with an N-terminal luminal domain and C-terminal cytoplasmic tail .

    • Conservation: Highly conserved from invertebrates to mammals (e.g., 70.7% similarity with Xenopus) .

FeatureDescription
LocalizationEndoplasmic reticulum (ER)
Key DomainsProline-rich cytoplasmic tail (9/29 residues), no N-glycosylation sites
ER RetentionMediated by TMD composition, not length or canonical motifs (K(X)KXX/RRXX)

Recombinant C4orf34: Production and Applications

ER Localization and Retention

  • Localization: Co-localizes with ER markers (calnexin, Sec61) . Deletion mutants lacking TMD localize to the cytoplasm, confirming TMD’s role in ER retention .

  • Topology Determination:

    • N-Glycosylation Assays: N-terminal luminal domain confirmed via glycosylation-induced band shifts in SDS-PAGE .

    • FKBP-Rapamycin System: C-terminal cytoplasmic tail confirmed by rapamycin-dependent recruitment of cytoplasmic proteins .

Potential Functional Roles

  • ER Stress Response: No upregulation under tunicamycin-induced stress, suggesting indirect involvement in ER homeostasis .

  • Protein Interactions: Proline-rich C-terminal tail may recruit SH3-domain proteins, analogous to transmembrane adaptor proteins (TRAPs) .

Key Gaps in Knowledge

  1. Molecular Interactions: Partners of the proline-rich C-terminal tail remain unidentified.

  2. Physiological Role: No direct link to Ca²⁺ homeostasis or ER stress pathways established .

  3. Pathological Relevance: No association with diseases reported despite chromosome 4’s linkage to Huntington’s and polycystic kidney disease .

Recommended Research Strategies

  • Interaction Mapping: Co-IP or proximity-dependent biotinylation to identify cytoplasmic binding partners.

  • Functional Knockdown: CRISPR/Cas9-mediated depletion to assess ER stress sensitivity.

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve TMD topology and interactions.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format we have in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SMIM14; C4orf34; Small integral membrane protein 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SMIM14
Target Protein Sequence
MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAW MVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVD
Uniprot No.

Target Background

Gene References Into Functions
  1. hC4orf34 is an endoplasmic reticulum-resident type I transmembrane protein. PMID: 24499674
Database Links

HGNC: 27321

KEGG: hsa:201895

STRING: 9606.ENSP00000295958

UniGene: Hs.205952

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is C4orf34 and where is it expressed?

C4orf34 (chromosome 4 open reading frame 34) is a highly conserved gene encoding a small protein of approximately 99 amino acids in humans. The protein is ubiquitously expressed across various tissues, with notable presence in the heart, thymus, hippocampus, and other organs as demonstrated through RT-PCR analysis of mouse tissues . Sequence analysis reveals C4orf34 is evolutionarily conserved from invertebrates to mammals, with approximately 89.7% amino acid sequence similarity between human and mouse orthologs, and 69.7-70.7% similarity with zebrafish and Xenopus versions . This high degree of conservation suggests functional importance despite its current "uncharacterized" status in protein databases.

What is the subcellular localization of C4orf34?

C4orf34 has been conclusively identified as an endoplasmic reticulum (ER)-resident type I transmembrane protein. Fluorescence microscopy studies with C4orf34-EGFP fusion proteins demonstrate a network-like distribution pattern including nuclear envelope localization, characteristic of ER proteins . Co-localization experiments with established ER markers such as calnexin and Sec61-EGFP confirm its ER targeting . The protein contains a single transmembrane domain (TMD) that appears critical for its ER retention, as demonstrated through mutational analysis of various domains .

What is the membrane topology of C4orf34?

C4orf34 adopts a type I transmembrane orientation, with its N-terminus positioned in the ER lumen and its C-terminus facing the cytoplasm. This topology was determined through two complementary experimental approaches:

  • N-glycosylation analysis: Introduction of artificial N-glycosylation sites in the N-terminal region resulted in detectable glycosylation (confirmed by tunicamycin treatment), while similar modifications to the C-terminal region did not produce glycosylated protein .

  • Rapamycin-inducible dimerization system: Using an FRB-fusion approach, researchers demonstrated that the C-terminus is accessible to cytoplasmic proteins, confirming its cytoplasmic orientation .

This topology positions the proline-rich C-terminal domain in the cytoplasm, suggesting potential interaction with cytoplasmic signaling proteins.

What are recommended methods for detecting endogenous C4orf34 expression?

For endogenous C4orf34 detection, a multi-technique approach is recommended:

  • RT-PCR: Design primers targeting different exons to distinguish cDNA amplification from genomic DNA contamination. For example, researchers successfully amplified C4orf34 from HeLa cDNA using nested PCR with specific primer sets .

  • Quantitative RT-PCR: For expression level changes, such as during ER stress conditions, quantitative PCR can be employed using appropriate reference genes (GAPDH, β-actin) for normalization .

  • Immunoblotting: While not explicitly detailed in current literature, antibodies against the C-terminal domain would be theoretically preferable due to its cytoplasmic localization facilitating improved accessibility.

  • Immunofluorescence microscopy: Detection should employ co-staining with established ER markers (calnexin, Sec61β) to verify the expected subcellular localization pattern .

What cloning strategies are effective for recombinant C4orf34 expression?

Based on published methodologies, the following approach is effective for C4orf34 cloning and expression:

  • RNA extraction and cDNA synthesis: Total RNA isolation from human cell lines (e.g., HeLa) followed by reverse transcription with oligo(dT) primers.

  • Nested PCR amplification: Use of sequential PCR reactions to increase specificity and yield:

    • First-round PCR using hC4orf34-S and hC4orf34-A1 primers

    • Second-round PCR using hC4orf34-S and hC4orf34-A2 primers

  • Vector selection: The protein has been successfully expressed using:

    • pEGFP-N3 vector for C-terminal EGFP fusion

    • pcDNA3.1 vector with C-terminal 3xFLAG tag

  • Restriction sites: HindIII and EcoRI restriction sites have been successfully used for directional cloning .

When designing expression constructs, it's critical to maintain the integrity of both N-terminal signal sequence and C-terminal transmembrane domain to ensure proper ER localization.

What methodologies can determine if C4orf34 interacts with other proteins?

Given the structural characteristics of C4orf34, several complementary approaches are recommended for investigating protein-protein interactions:

  • Co-immunoprecipitation: Using epitope-tagged C4orf34 constructs (3xFLAG, HA, etc.) to pull down potential interacting partners, followed by mass spectrometry identification. Special attention should be paid to the proline-rich C-terminal domain, which potentially serves as a binding site for SH3 domain-containing proteins .

  • Proximity labeling approaches: BioID or APEX2 fusion to C4orf34 would enable biotinylation of proximal proteins in the native cellular environment, identifying the proximal proteome.

  • Yeast two-hybrid screening: Using the C-terminal domain as bait to screen for interacting partners, with verification through secondary assays.

  • Protein complementation assays: Split-YFP, split-luciferase, or similar approaches using C4orf34 fusion constructs to visualize interactions in live cells.

Since C4orf34 contains a proline-rich domain at its C-terminus with several PXXP motifs, particular attention should be directed toward potential interactions with SH3 domain-containing proteins .

What role might C4orf34 play in ER stress response pathways?

While initial studies suggest C4orf34 gene expression is not altered during ER stress conditions , several experimental approaches could further elucidate its potential role:

  • Loss-of-function studies:

    • siRNA or CRISPR-Cas9 knockout of C4orf34 followed by analysis of:

      • Unfolded protein response (UPR) markers (BiP/GRP78, CHOP, XBP1 splicing)

      • ER morphology changes (by transmission electron microscopy)

      • Sensitivity to ER stressors (tunicamycin, thapsigargin, DTT)

  • Calcium homeostasis assessment:

    • Calcium imaging using fluorescent indicators in C4orf34-depleted cells

    • Analysis of calcium release upon stimulation with IP3-generating agonists

    • Investigation of store-operated calcium entry (SOCE) components

  • Interactome changes:

    • Comparing C4orf34 protein interactions under normal versus ER stress conditions

    • Analysis of post-translational modifications during stress

Current literature suggests a possible role in calcium homeostasis based on its ER localization, but direct experimental evidence is still needed .

How can researchers investigate the role of C4orf34's transmembrane domain in ER retention?

The transmembrane domain (TMD) of C4orf34 appears critical for its ER localization . Several experimental approaches can further characterize this function:

  • TMD substitution/chimera analysis: Replace the C4orf34 TMD with TMDs from proteins targeted to different compartments (plasma membrane, Golgi, etc.) to assess localization changes.

  • Systematic mutagenesis:

    • Alanine scanning mutagenesis of TMD residues

    • Hydrophobicity alterations (e.g., replacement with leucine stretches)

    • Length modifications to test TMD thickness matching with the ER membrane

  • Trafficking assays:

    • Temperature-sensitive trafficking blocks (15°C, 20°C) to arrest protein at various compartments

    • Brefeldin A treatment to assess Golgi-dependent trafficking

    • RUSH (Retention Using Selective Hooks) system to synchronize and visualize trafficking

  • Interaction studies with ER retention machinery:

    • Investigation of potential interactions with KDEL receptors, BAP31, or other ER retention/retrieval proteins

    • Analysis of association with ER membrane protein complexes

These approaches should be complemented with quantitative microscopy to accurately measure subcellular distribution changes.

What experimental designs can elucidate potential roles of C4orf34 in calcium homeostasis?

As an ER-resident protein, C4orf34 may participate in calcium regulatory processes. The following experimental approaches would be informative:

  • Real-time calcium measurements:

    • Genetically encoded calcium indicators (GECIs) targeted to ER lumen and cytosol in C4orf34 knockout/overexpression models

    • Fura-2 ratiometric imaging to quantify cytosolic calcium levels

  • Calcium channel interaction studies:

    • Co-immunoprecipitation with major ER calcium channels (IP3Rs, RyRs, SERCA)

    • Functional assays measuring channel activity in the presence/absence of C4orf34

  • SOCE component analysis:

    • Assessment of STIM1 puncta formation and Orai1 activation in C4orf34-depleted cells

    • Calcium release-activated current (CRAC) measurements through electrophysiology

  • ER calcium store capacity measurements:

    • Thapsigargin-induced calcium release quantification

    • Direct measurement of ER luminal calcium using ER-targeted aequorin or GECI probes

These studies should include appropriate controls and multiple cell types to establish the generality of any observed phenotypes.

What evolutionary insights can be derived from C4orf34 conservation across species?

The high conservation of C4orf34 across vertebrates and even invertebrates suggests important functional roles. Researchers can explore evolutionary aspects through:

  • Phylogenetic analysis:

    • Construction of comprehensive phylogenetic trees using C4orf34 orthologs

    • Analysis of selection pressure (dN/dS ratios) to identify functionally critical regions

    • Identification of lineage-specific changes that may correlate with physiological adaptations

  • Domain structure comparison:

    • Analysis of conservation patterns in different domains (N-terminus, TMD, C-terminus)

    • Identification of absolutely conserved residues as potentially functionally critical

    • Comparison with related protein families to identify potential functional clues

  • Expression pattern analysis across species:

    • Comparative analysis of tissue expression patterns in model organisms

    • Correlation of expression with tissue-specific functions

The current literature indicates approximately 89.7% amino acid similarity between human and mouse C4orf34, with 69.7% similarity to zebrafish and 70.7% to Xenopus orthologs , providing a strong foundation for comparative studies.

What approaches can identify potential functional homologs of C4orf34?

Beyond simple sequence homology, researchers can employ several strategies to identify functional relationships:

  • Structural homology modeling:

    • Prediction of C4orf34 structure using AI-based tools (AlphaFold, RoseTTAFold)

    • Structural alignment with known proteins to identify potential functional similarities

    • Analysis of binding pocket or active site predictions

  • Co-evolution analysis:

    • Identification of proteins that show correlated evolutionary patterns with C4orf34

    • Analysis of genetic interaction networks across species

  • Comparative interactomics:

    • Comparing interacting partners of C4orf34 orthologs across species

    • Identification of conserved interaction networks

  • Gene neighborhood analysis:

    • Examination of genomic context and gene clustering across species

    • Identification of operons or functionally related gene clusters in prokaryotic homologs

These approaches could potentially connect C4orf34 to better-characterized protein families and provide clues to its cellular functions.

What methodologies can assess potential links between C4orf34 and disease states?

While no direct disease associations have been established for C4orf34, several approaches can investigate potential links:

  • Genetic association studies:

    • Analysis of GWAS data for SNPs in or near C4orf34

    • Exome sequencing data mining for rare variants in patient populations

    • eQTL analysis to identify expression-modulating variants

  • Differential expression analysis:

    • Comparison of C4orf34 expression levels in disease vs. normal tissues

    • Analysis of public transcriptomics databases (TCGA, GTEx) for expression patterns

    • Single-cell RNA-seq data mining to identify cell-type specific changes in disease states

  • Functional characterization in disease models:

    • Knockout/knockdown in cellular disease models to assess phenotypic effects

    • Overexpression studies to evaluate protective or detrimental effects

    • Rescue experiments in relevant disease models

Given its ER localization and potential role in calcium homeostasis or ER stress, particular attention should be paid to diseases involving ER dysfunction, such as neurodegenerative disorders, diabetes, and certain cancer types.

How can researchers investigate if C4orf34 interacts with the unfolded protein response (UPR)?

The potential relationship between C4orf34 and UPR pathways can be investigated through:

  • UPR pathway activation analysis:

    • Assessment of the three UPR branches (PERK, IRE1, ATF6) in C4orf34 manipulated cells

    • Quantification of downstream UPR targets (CHOP, BiP, XBP1 splicing) using RT-qPCR, immunoblotting, and reporter assays

    • Time-course experiments to capture temporal dynamics of UPR activation

  • Direct interaction studies:

    • Co-immunoprecipitation with key UPR sensors (PERK, IRE1, ATF6)

    • Proximity labeling to identify potential interactions with UPR components

    • FRET/BRET assays to detect direct protein-protein interactions in live cells

  • Stress sensitivity profiling:

    • Viability/apoptosis assays in C4orf34-depleted cells exposed to various ER stressors

    • Complementation studies with specific UPR pathway inhibitors

Initial studies indicate that C4orf34 expression itself is not altered during ER stress conditions , suggesting it may function constitutively rather than as a stress-induced factor, but it could still play regulatory roles in UPR signaling pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.