Recombinant Human Uncharacterized protein C5orf50 (C5orf50)

Shipped with Ice Packs
In Stock

Description

Recombinant Protein Production

The recombinant form (Product Code: CSB-EP004029HU1) is produced in E. coli and available commercially for research purposes :

ParameterSpecification
Purity>85% (SDS-PAGE verified)
Storage- Lyophilized: -20°C/-80°C for 12 months
- Reconstituted: 4°C for 1 week
Reconstitution0.1–1.0 mg/mL in sterile water with 50% glycerol recommended
Immunogen SpeciesHomo sapiens (UniProt ID: A6NLE4)

Functional Insights

Biological Roles:

  • Facial Morphogenesis: Genome-wide association studies (GWAS) identified C5orf50 as influencing zygomatic (cheekbone) and nasion (nose bridge) distances in Europeans .

  • Developmental Pathways: Located near FBXW11 (a Sonic Hedgehog signaling gene), suggesting potential regulatory crosstalk .

Protein Interactions:

Interacting ProteinFunction
CFAP43 (WDR96)Cilia/flagella-associated protein with tryptophan-aspartic acid repeats
COL17A1Collagen type XVII involved in epidermal-dermal adhesion
PRDM16Transcriptional regulator of adipocyte differentiation

Clinical and Research Significance

Key Findings:

  • GWAS Associations:

    PhenotypeSNP (rs6555969) Effect SizeP-valueCohort Size
    Zygion-Nasion Distanceβ = 0.41 (mm)1.17×10⁻⁹5,388 adults
    Eye Landmark Positionsβ = 0.24–0.262.05×10⁻⁸Replicated in 3,867 individuals
  • Structural Ambiguities: Conflicting subcellular localization predictions (endoplasmic reticulum vs. cytosol) suggest possible misannotation or isoform-specific trafficking .

Research Challenges and Future Directions

  • Functional Characterization: No direct mechanistic studies exist; current insights derive from GWAS and in silico analyses .

  • Isoform Discrepancies: The 172-aa and 371-aa isoforms require biochemical validation to resolve conflicting molecular weight observations (predicted 20 kDa vs. observed 40 kDa in Western blots) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SMIM23; C5orf50; Small integral membrane protein 23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SMIM23
Target Protein Sequence
MATQQVDSRRQVAAEQVAAQLLERRRGSHCDDEKQTLLALLILVLYLSTEIWGSSWEVSERIRECNYYQNLAVPQGLEYQTNEPSEEPIKTIRNWLKEKLHVFSEKLEEEVQQLEQLAWDLELWLDALLGEPHQEEHCSTYKSHLHLEHEVSIRDH
Uniprot No.

Target Background

Gene References Into Functions
  1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
Database Links

HGNC: 34440

KEGG: hsa:644994

STRING: 9606.ENSP00000331214

UniGene: Hs.591740

Subcellular Location
Cell membrane; Single-pass type II membrane protein.

Q&A

What is C5orf50 and why is it of interest to researchers?

C5orf50 (Chromosome 5 Open Reading Frame 50) is an uncharacterized protein encoded by a gene located on chromosome 5 in humans. The protein has gained interest in the research community primarily due to its genetic associations with certain phenotypic traits. Notably, genome-wide association studies have revealed that a single nucleotide polymorphism (SNP) near C5orf50, specifically rs6555969, is associated with upper facial depth, which approximates the zygion-nasion distance . The protein's function remains largely uncharacterized, making it an intriguing target for fundamental research in human genetics and potential phenotypic associations.

What genetic associations have been identified for C5orf50?

Current research has established associations between C5orf50 and craniofacial measurements. Specifically, the SNP rs6555969 near C5orf50 has been linked to upper facial depth (p = 0.005) . Additionally, this same SNP (rs6555969) has shown association with intercanthal width (p = 0.049), suggesting C5orf50's potential role in multiple aspects of facial development . These associations were identified through genome-wide association studies and have been replicated across different populations, indicating their robustness. Researchers investigating facial morphology should consider these genetic markers when designing studies examining the genetic architecture of human facial traits.

How does C5orf50 compare to other uncharacterized proteins in terms of research priority?

When prioritizing uncharacterized proteins for research, C5orf50 presents several compelling advantages. Its documented genetic associations with measurable phenotypic traits (facial morphology) provide concrete endpoints for functional studies . Unlike many uncharacterized proteins with no known associations, C5orf50's connection to facial development offers a starting point for hypothesis generation. Additionally, the availability of specific research tools such as CRISPR/Cas9 vectors targeting C5orf50 facilitates experimental manipulation . When designing a research program, consider these factors alongside conservation analysis, protein domain predictions, and expression patterns to determine if C5orf50 merits priority over other uncharacterized proteins in your specific research context.

What CRISPR/Cas9 approaches are available for C5orf50 functional studies?

For CRISPR/Cas9-mediated functional studies of C5orf50, researchers can utilize commercially available C5orf50 sgRNA CRISPR/Cas9 All-in-One Non-viral Vector sets. These typically include three sgRNA targets designed to guide Cas9 to cleave exonic gDNA, resulting in frameshift mutations that effectively knock out the gene . The experimental approach should follow these methodological steps:

  • Select an appropriate vector system (All-in-One vectors containing both Cas9 and sgRNA expression elements are available)

  • Transfect target cells using optimized protocols for your cell type

  • Select for successfully transfected cells (vectors often include selection markers such as GFP)

  • Verify knockout efficiency through sequencing or functional assays

  • Conduct phenotypic analyses relevant to facial development or other hypothesized functions

When designing your experiment, consider including proper controls such as non-targeting sgRNAs and rescue experiments to confirm phenotype specificity.

How should researchers design experiments to investigate C5orf50's role in facial morphology?

When investigating C5orf50's role in facial morphology, design your experiments using a multi-level approach:

  • Genetic association validation: Confirm the association between rs6555969 and facial measurements (upper facial depth and intercanthal width) in your study population

  • Expression analysis: Characterize C5orf50 expression patterns during embryonic development, focusing on craniofacial tissues using techniques such as in situ hybridization or immunohistochemistry

  • Loss-of-function studies: Implement CRISPR/Cas9-mediated knockout in appropriate model systems . Consider:

    • Cell models: Derive neural crest cells (precursors to facial tissues) from iPSCs with C5orf50 knockout

    • Animal models: Generate conditional knockout animals focusing on craniofacial development

  • Measurement standardization: Implement standardized facial measurement techniques as described in genome-wide association studies :

    Facial MeasurementDescriptionAssociated SNPP-value
    Upper facial depthApproximation of zygion-nasion distancers6555969 (near C5orf50)0.005
    Intercanthal widthDistance between medial canthirs6555969 (near C5orf50)0.049
  • Pathway analysis: Investigate potential interactions with known craniofacial development pathways (e.g., PAX3, MAFB)

This comprehensive approach ensures robust investigation of C5orf50's functional role in facial development while maintaining methodological rigor.

What are the optimal cell models for studying C5orf50 function?

When selecting cell models for C5orf50 functional studies, consider these methodological factors:

  • Expression profile matching: Choose cell types that naturally express C5orf50 to ensure physiological relevance. Neural crest-derived cells are recommended given the protein's association with facial development

  • Developmental relevance: For facial morphology studies, consider:

    • Human neural crest cells (hNCCs)

    • Human mesenchymal stem cells (hMSCs)

    • Osteoblast precursor cell lines (e.g., MC3T3-E1)

  • Genetic manipulation accessibility: Select cell models amenable to CRISPR/Cas9 transfection with the C5orf50 sgRNA vectors . Consider:

    • Transfection efficiency

    • Selection marker compatibility

    • Genomic stability

  • Phenotypic assessment capability: Ensure your cell model allows for measurement of relevant phenotypes, such as:

    • Migration assays (for neural crest cell behavior)

    • Differentiation potential into craniofacial tissues

    • Gene expression profiling of craniofacial development markers

  • 3D culture potential: Consider organoid or 3D culture systems that better recapitulate the spatial organization of developing facial structures

The optimal approach often combines multiple cell models to cross-validate findings and capture different aspects of C5orf50 function across developmental contexts.

How do SNPs near C5orf50 contribute to facial phenotype variations?

The relationship between SNPs near C5orf50 and facial phenotype variations follows several potential mechanistic pathways:

  • Regulatory effects: The SNP rs6555969 near C5orf50 likely affects gene regulation rather than protein function . It may:

    • Alter transcription factor binding sites affecting C5orf50 expression levels

    • Influence enhancer/repressor interactions

    • Modify chromatin accessibility in facial development contexts

  • Developmental timing effects: The variant may alter the temporal expression pattern of C5orf50 during critical windows of facial development, affecting:

    • Neural crest cell migration

    • Mesenchymal condensation

    • Osteoblast differentiation and activity

  • Tissue-specific effects: The association with specific facial measurements (upper facial depth, p = 0.005; intercanthal width, p = 0.049) suggests tissue-specific effects . The variant likely influences:

    • Regional growth rates during facial development

    • Boundary formation between facial prominences

    • Tissue interactions at specific facial landmarks

  • Interaction with environmental factors: The phenotypic manifestation may depend on environmental contexts such as:

    • Maternal nutrition during development

    • Exposure to teratogens

    • Mechanical forces during facial growth

To investigate these mechanisms, researchers should design experiments that examine gene expression changes in the presence of different allelic variants, ideally in developmental models that recapitulate facial morphogenesis.

What is the relationship between C5orf50 and other genes associated with facial morphology?

C5orf50 functions within a complex genetic network influencing facial morphology:

  • Coordinate action with established facial morphology genes: Genome-wide association studies have identified several genes involved in facial development that may interact with C5orf50, including:

    • PAX3: Associated with nasion position (rs974448, p = 0.002 for intercanthal width)

    • MAFB: Located 410kb from a SNP associated with cranial base width

    • TP63: Involved in interorbital distance development

  • Pathway integration: C5orf50 likely participates in established developmental pathways:

    • Neural crest specification and migration

    • Mesenchymal-epithelial interactions

    • Osteoblast differentiation and function

  • Potential genetic interactions: Experimental evidence suggests possible epistatic relationships:

    • Combined effects of C5orf50 and PAX3 variants may influence intercanthal width more dramatically than either variant alone

    • The proximity of associations for both genes suggests potential shared regulatory mechanisms

  • Evolutionary conservation: Comparative genomics can reveal functional relationships:

    • Examine if C5orf50 and known facial morphology genes show similar patterns of evolutionary conservation

    • Investigate co-expression patterns across species

To define these relationships experimentally, consider co-immunoprecipitation studies, chromatin conformation capture, or double-knockout experiments to identify genetic interactions between C5orf50 and established facial morphology genes.

How can researchers differentiate direct versus indirect effects of C5orf50 on phenotype?

Differentiating direct from indirect effects of C5orf50 on facial phenotypes requires a systematic experimental approach:

  • Temporal manipulation studies:

    • Use inducible CRISPR systems to knock out C5orf50 at different developmental timepoints

    • Monitor changes in facial measurements after knockout at each stage

    • Direct effects will manifest shortly after knockout, while indirect effects may require longer timeframes

  • Pathway dissection:

    • Perform RNA-seq after C5orf50 knockout to identify immediately affected genes

    • Use pharmacological inhibitors to block downstream pathways while measuring phenotypic outcomes

    • Construct a temporal map of transcriptional changes following C5orf50 perturbation

  • Protein interaction analyses:

    • Identify direct binding partners of C5orf50 through techniques like BioID or IP-MS

    • Validate interactions through co-immunoprecipitation or FRET analysis

    • Create interaction-deficient mutants to determine which interactions mediate which phenotypic effects

  • Rescue experiments with domain specificity:

    • Design rescue constructs expressing specific domains of C5orf50

    • Determine which domains are necessary and sufficient for phenotypic rescue

    • Map phenotypic effects to molecular functions of specific protein regions

  • Cross-species validation:

    • Compare C5orf50 function across species with different facial morphologies

    • Identify conserved versus divergent mechanisms affecting facial measurements

This comprehensive approach helps distinguish primary molecular functions of C5orf50 from secondary effects propagating through developmental networks.

What are the challenges in interpreting GWAS data related to C5orf50?

Interpreting genome-wide association study (GWAS) data for C5orf50 presents several methodological challenges:

  • Linkage disequilibrium complexities: The SNP rs6555969 near C5orf50 associated with facial measurements may not be the causal variant, but rather in linkage disequilibrium with the true functional variant. Researchers should:

    • Perform fine-mapping studies to identify all variants in the associated region

    • Use population-specific LD patterns to narrow the causal variant candidates

    • Consider that the associated variant may actually affect neighboring genes

  • Phenotypic measurement standardization: Facial measurements vary in definition and methodology across studies:

    • The association with "upper facial depth" requires standardized measurement protocols

    • Different studies may use slightly different landmarks or measurement techniques

    • 3D versus 2D measurements may yield different association strengths

  • Pleiotropy versus causality: The association of rs6555969 with both upper facial depth and intercanthal width raises questions about:

    • Whether C5orf50 independently affects multiple traits

    • If one phenotype is secondary to another

    • Potential confounding variables affecting both measurements

  • Population stratification: Facial morphology varies substantially across populations:

    • Genetic associations may differ in effect size or direction across ancestral groups

    • The p-value of 0.005 for upper facial depth association should be interpreted in the context of the study population

    • Replication across diverse populations is essential for robust interpretation

To address these challenges, implement meta-analytic approaches across studies, conduct trans-ethnic fine-mapping, and develop standardized phenotyping protocols for facial measurements.

How should researchers approach contradictory data regarding C5orf50 function?

When confronting contradictory data about C5orf50 function, implement this methodological framework:

  • Context-dependent analysis:

    • Catalog experimental conditions across contradictory studies (cell types, developmental stages, measurement techniques)

    • Test if contradictions resolve when controlling for these variables

    • Consider that C5orf50 may have context-dependent functions

  • Technical validation:

    • Evaluate the specificity of antibodies or CRISPR guides used

    • Assess knockout efficiency and potential compensatory mechanisms

    • Compare protein detection methods (western blot vs. mass spectrometry)

  • Isoform-specific functions:

    • Determine if studies examined different C5orf50 isoforms

    • Design isoform-specific knockdown/knockout experiments

    • Characterize expression patterns of each isoform across relevant tissues

  • Reconciliation through computational models:

    • Develop mathematical models incorporating seemingly contradictory data

    • Identify parameters that could explain divergent results

    • Design experiments to test model predictions

  • Collaborative resolution strategy:

    • Organize collaborative experiments between labs reporting contradictory results

    • Standardize protocols and share reagents

    • Perform blinded analyses to minimize bias

Document all reconciliation attempts in your publications, as the process of resolving contradictions often reveals important biological insights about context-dependent protein functions.

What are the considerations for translating C5orf50 research from model systems to human applications?

Translating C5orf50 research from model systems to human applications requires careful methodological consideration:

  • Cross-species conservation assessment:

    • Determine the degree of sequence and functional conservation of C5orf50 across species

    • Compare syntenic regions around C5orf50 to identify conserved regulatory elements

    • Validate if the SNP rs6555969 associated with human facial traits exists or has functional homologs in model organisms

  • Phenotypic scaling considerations:

    • Establish how facial measurements in model organisms correspond to human measurements

    • Develop standardized methods to quantify comparable features across species

    • Consider allometric relationships when comparing phenotypic effects

  • Developmental timing differences:

    • Map equivalent developmental stages between models and humans

    • Account for differences in the timing of neural crest migration and facial prominence formation

    • Adjust experimental interventions to target homologous developmental windows

  • Functional validation in human cells:

    • Use CRISPR/Cas9 systems optimized for human cells to validate findings

    • Derive neural crest cells from human iPSCs with C5orf50 modifications

    • Employ human organoid models to bridge the gap between animal models and clinical applications

  • Ethical considerations for human studies:

    • Develop clear protocols for obtaining informed consent when studying human facial genetics

    • Address potential concerns about facial recognition and privacy

    • Consider the social implications of research linking genetics to facial features

By systematically addressing these considerations, researchers can increase the translational relevance of C5orf50 findings while maintaining scientific rigor.

What are the optimal conditions for expression and purification of recombinant C5orf50?

For optimal expression and purification of recombinant C5orf50, implement this methodological approach:

  • Expression system selection:

    • Mammalian systems (HEK293T, CHO cells) are preferred for human C5orf50 to ensure proper folding and post-translational modifications

    • Consider inducible expression systems to mitigate potential toxicity

    • For structural studies requiring higher yields, insect cell systems (Sf9, Hi5) offer a compromise between yield and proper processing

  • Vector design optimization:

    • Include a cleavable affinity tag (His6, FLAG, or GST) for purification

    • Consider codon optimization for the expression system

    • Include a secretion signal if extracellular expression is desired

  • Expression conditions:

    • For mammalian systems, culture at 37°C until induction, then reduce to 30-32°C

    • Optimize induction timing based on cell density

    • For difficult-to-express constructs, add chemical chaperones (e.g., 4-PBA, DMSO at low concentrations)

  • Purification protocol:

    • Begin with affinity chromatography using the engineered tag

    • Follow with size exclusion chromatography to ensure homogeneity

    • Validate protein identity via mass spectrometry

    • Assess protein quality through circular dichroism or thermal shift assays

  • Stability optimization:

    • Screen buffer conditions using differential scanning fluorimetry

    • Typical starting buffers: 25-50 mM Tris or HEPES pH 7.4-8.0, 150 mM NaCl

    • Consider adding glycerol (5-10%) for long-term storage

Validate the functionality of your recombinant protein through activity assays or binding studies with predicted interaction partners identified in facial development pathways.

How should researchers troubleshoot failed C5orf50 knockout experiments using CRISPR/Cas9?

When troubleshooting failed C5orf50 knockout experiments using CRISPR/Cas9, follow this systematic approach:

  • Guide RNA efficiency validation:

    • Perform T7 endonuclease I assay to verify guide cutting efficiency

    • Consider that the commercially available C5orf50 sgRNA CRISPR/Cas9 vectors include three sgRNA targets ; test each independently

    • Use online tools to assess potential off-target effects

  • Transfection optimization:

    • Verify transfection efficiency using the GFP marker included in the vector system

    • Optimize transfection conditions (reagent, cell density, DNA concentration)

    • Consider cell type-specific protocols; hard-to-transfect cells may require electroporation

  • Clone selection strategy:

    • Implement single-cell cloning rather than working with mixed populations

    • Screen multiple clones (minimum 10-20) for knockout validation

    • Consider that C5orf50 may be essential in your cell model; look for heterozygous clones

  • Knockout verification methods:

    • Use multiple verification approaches:

      • Genomic sequencing of the target region

      • Western blotting (if antibodies are available)

      • RT-qPCR to assess transcript levels

      • Targeted proteomics if western blotting is inconclusive

  • Addressing compensation mechanisms:

    • Consider acute knockout systems (e.g., inducible Cas9) if compensation is suspected

    • Verify expression of closely related genes that might compensate for C5orf50 loss

    • Implement combinatorial knockouts if paralogs are identified

  • Technical details for C5orf50-specific troubleshooting:

    • The C5orf50 sgRNA CRISPR/Cas9 vector (Cat. No. 14587131) uses a pNV-sgRNA-Cas9-2A-GFP backbone

    • Verify that your sequencing primers flank the target site specified in the product documentation

    • Store reagents at -20°C or below as recommended

Document all troubleshooting steps methodically to inform future experimental design and contribute to the technical knowledge base for C5orf50 research.

What analytical methods are most appropriate for detecting subtle facial phenotypes in C5orf50 research?

For detecting subtle facial phenotypes in C5orf50 research, implement these advanced analytical methods:

These methods collectively enable detection of subtle facial phenotypes that might be missed by conventional measurements, critical for understanding C5orf50's role in facial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.