Recombinant Human Uncharacterized protein C7orf13 (C7orf13)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human Uncharacterized Protein C7orf13

The Recombinant Human Uncharacterized protein C7orf13, encoded by the C7orf13 gene, is a protein whose function is not yet fully understood . Research indicates that C7orf13 may play a role in various cellular processes, and its expression levels can be associated with certain diseases . Due to the limited characterization, studies often focus on its genetic behavior and expression patterns under different conditions to infer its potential functions .

Gene and Protein Structure

The C7orf13 gene is located on chromosome 7 . The protein encoded by this gene has been identified in various tissues, with notable expression levels observed in certain cancers . Molecular cloning has allowed for the identification of the coding sequence (CDS) region of related genes such as C11orf96, providing a template for C7orf13 studies . The CDS region is 372 bp long, encoding 124 amino acids, and is relatively conserved in different mammals . Bioinformatics analysis has revealed that C11orf96 is rich in Ser and has multiple predicted phosphorylation sites . Protein interaction prediction analysis revealed that the protein is associated with several transmembrane family proteins and zinc finger proteins . The C11orf96 protein consists of four structures: α-helix, β-turn, random coil, and extended chain, which account for 61%, 4%, 33%, and 2% of the protein structure, respectively .

Expression Patterns and Tissue Distribution

C7orf13 exhibits varying expression patterns across different tissues . Studies on related proteins, such as C11orf96, have shown a high messenger RNA transcription level in the kidney, suggesting a potential role in the biological activities of this organ . In proneural glioblastomas, C7orf13 underexpression is linked to chromosome 7 gain, with its expression inversely associated with patient survival .

Role in Disease

Decreased expression of C7orf13 has been observed in proneural glioblastomas, where it is inversely correlated with HOXA5 expression . High HOXA5 expression is associated with increased cell proliferation and radioresistance in glioblastomas, suggesting that C7orf13 may have a tumor-suppressive role in this context . Furthermore, methylation profiling has identified C7orf13 as highly methylated in association with chromosome 7 gain in proneural glioblastomas, which inversely correlates with gene expression .

Research Findings

  • Glioblastomas: In proneural glioblastomas, C7orf13 expression is inversely correlated with survival. Methylation of the C7orf13 promoter is associated with chromosome 7 gain and inversely correlated with gene expression .

  • Nasopharyngeal Carcinoma (NPC): LncRNA C7orf13 promotes cell proliferation and metastasis in NPC .

  • Type 1 Diabetes (T1D): Genome-wide association studies have explored C7orf13 in the context of T1D risk loci .

Methodological Approaches

Research into C7orf13 and similar uncharacterized proteins involves a range of methods:

  • Bioinformatics Analysis: Utilized to predict protein interactions, identify phosphorylation sites, and analyze sequence conservation across species .

  • Expression Studies: Relative quantitative PCR and Western blotting are used to analyze messenger RNA and protein levels in different tissues .

  • Methylation Profiling: Used to assess DNA methylation patterns and their correlation with gene expression .

  • Proteogenomics: Integrates proteomics and genomics data to improve gene/protein models .

Data Table: C11orf96 Expression in Cat Tissues

This data table displays the expression levels of C11orf96 in various cat tissues, as analyzed by relative quantitative PCR. These findings suggest tissue-specific roles for C11orf96, particularly in the kidney .

TissueRelative mRNA Level
KidneyHighest
HeartHigh
(Other tissues)Various

Future Directions

Further research is needed to elucidate the precise functions of C7orf13. Potential areas of investigation include:

  • Functional Assays: Conducting in vitro and in vivo experiments to determine the specific cellular processes in which C7orf13 is involved.

  • Protein Interaction Studies: Identifying and characterizing the proteins that interact with C7orf13 to understand its role in cellular pathways .

  • Disease Association Studies: Investigating the expression and regulation of C7orf13 in a wider range of diseases to identify potential therapeutic targets.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LINC01006; C7orf13; MY040; Putative uncharacterized protein encoded by LINC01006; Long intergenic non-protein coding RNA 1006
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
LINC01006
Target Protein Sequence
MLASPARPTLRMLANHALSTPHCACSPAPAPRTASASRRRCVPVEARAAGVFGDRLAGVF GSRGLKHGGVQAPRPRVVRAEPRAGFAVVRSPRRLCGRSHAPQPPAHLGLGPGCFPAVAV VVPVPGSRAHRPFAALLVEGSFLGDPPIPPRRSGVLARGSAGADCLASSVTPGPSLWIPL LLVAGCVSCFVGLAVCVWMQARVSPAWPAGLFLLPR
Uniprot No.

Target Background

Database Links

HGNC: 48971

OMIM: 610242

STRING: 9606.ENSP00000331784

UniGene: Hs.647014

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed only in testis.

Q&A

What is C7orf13 and how is it classified in current genomic databases?

C7orf13 was initially designated as an uncharacterized protein, but current research classifies it as LINC01006, a long intergenic non-protein coding RNA . Located on chromosome 7, it is part of the approximately 1,000 genes encoded by this chromosome, which makes up about 5% of the human genome . Despite being initially annotated as a protein-coding gene, its function as a long non-coding RNA is now better established through transcriptomic analyses. The gene product has been provisionally designated C7orf13 pending further characterization .

How should recombinant C7orf13 protein be stored and handled for optimal stability?

For optimal stability, recombinant C7orf13 protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use. Repeated freeze-thaw cycles should be avoided . The lyophilized powder can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add 5-50% glycerol (with 50% being the default final concentration) and aliquot before storing at -20°C/-80°C . Working aliquots can be stored at 4°C for up to one week .

What expression systems are most effective for producing recombinant C7orf13 protein?

Based on commercially available recombinant C7orf13 proteins, E. coli has been successfully used as an expression system . The recombinant full-length human C7orf13 protein (Q8NI28) spanning amino acids 1-216 has been produced with an N-terminal His tag in E. coli . This bacterial expression system appears effective for generating functional protein for research applications. Researchers should consider testing mammalian expression systems when studying post-translational modifications or when proper protein folding is critical for functional studies.

What antibodies are available for C7orf13 detection, and what are their applications?

Anti-C7ORF13 rabbit polyclonal antibodies are commercially available, including those conjugated with fluorescent markers such as ALEXA FLUOR® 750 . These antibodies are generally raised against an immunogen range covering amino acids 1-100/216 of the protein . Applications include immunofluorescence microscopy, flow cytometry, and potentially Western blotting, though specific validation for each application should be verified before experimental use. When selecting antibodies, researchers should consider the host species (rabbit in this case), clonality (polyclonal), and the specific epitope targeted to ensure compatibility with their experimental design.

How can researchers effectively validate the expression and function of C7orf13 in cellular models?

For validating C7orf13 expression and function:

  • Expression validation: Real-time quantitative PCR (RT-qPCR) has been effectively used to determine C7orf13 expression levels in nasopharyngeal carcinoma tissues and cell lines .

  • Functional validation: Knockdown experiments using siRNA or shRNA targeting C7orf13 have been employed to assess its role in cell proliferation, migration, and invasion . These functional assays should include appropriate controls and multiple cell lines to ensure reproducibility.

  • Molecular interaction studies: RNA immunoprecipitation and dual-luciferase reporter assays have been successfully used to investigate the interaction between C7orf13 and its target microRNAs (miR-449c and miR-28-5p) .

  • Pathway analysis: Researchers should consider examining downstream effectors such as FMNL2, which has been shown to have a positive relationship with C7orf13 in nasopharyngeal carcinoma tissues .

What is the association between C7orf13 expression and nasopharyngeal carcinoma progression?

Research has demonstrated that C7orf13 is overexpressed in nasopharyngeal carcinoma (NPC) tissues compared to normal tissues, and this overexpression is associated with malignant features of the cancer . Functional studies have shown that C7orf13 knockdown significantly suppresses proliferation, migration, and invasion of NPC cells, suggesting its oncogenic role in NPC progression . Furthermore, C7orf13 has been shown to sequester miR-449c and miR-28-5p in NPC cells, thereby positively regulating FMNL2 expression, which promotes cell invasion and migration . This indicates that C7orf13 contributes to NPC progression through a microRNA-mediated regulatory mechanism.

How does C7orf13 expression correlate with patient survival in glioblastoma?

Among the genes on chromosome 7, C7orf13 is one of the genes whose expression changes have shown the strongest association with patient survival in glioblastoma . While the specific mechanism of C7orf13 in glioblastoma hasn't been fully elucidated in the provided search results, it's noteworthy that gain of whole chromosome 7 is an early event in gliomagenesis that occurs in proneural-like precursor cells . Given that C7orf13 is located on chromosome 7, its increased expression due to chromosomal gain may contribute to the aggressive phenotype of glioblastoma and potentially affect patient outcomes. Further research specifically targeting C7orf13's role in glioblastoma is warranted to clarify its prognostic significance.

What methodologies have been validated for studying C7orf13's role in tumorigenesis?

Several methodologies have been validated for studying C7orf13's role in tumorigenesis:

  • Gene expression analysis: RT-qPCR has been used to quantify C7orf13 expression levels in cancer tissues compared to normal tissues .

  • Loss-of-function studies: RNA interference (siRNA/shRNA) targeting C7orf13 has been employed to investigate its function in cancer cell proliferation, migration, and invasion .

  • Molecular interaction assays:

    • Dual-luciferase reporter assays have been used to confirm direct interactions between C7orf13 and microRNAs .

    • RNA immunoprecipitation analysis has validated the binding of C7orf13 to specific miRNAs .

  • Cell-based functional assays: Migration and invasion assays have been utilized to assess the effect of C7orf13 manipulation on cancer cell behavior .

  • Correlation studies: Analysis of the relationship between C7orf13 expression and downstream targets (e.g., FMNL2) in cancer tissues has provided insights into its molecular mechanisms .

How does C7orf13 interact with the miR-449c/miR-28-5p-FMNL2 axis in cancer?

C7orf13 functions as a competing endogenous RNA (ceRNA) that sequester miR-449c and miR-28-5p in nasopharyngeal carcinoma cells . Through dual-luciferase reporter assays and RNA immunoprecipitation analysis, research has confirmed that C7orf13 directly binds to these microRNAs . This interaction prevents these microRNAs from binding to their target gene, formin-like 2 (FMNL2), thereby upregulating FMNL2 expression . FMNL2, in turn, promotes cell invasion and migration in NPC . Experimental data has shown that C7orf13 has a positive relationship with FMNL2 in NPC tissues, and C7orf13 knockdown weakens FMNL2-mediated cell invasion and migration . This regulatory axis (C7orf13-miR-449c/miR-28-5p-FMNL2) represents a critical mechanism by which C7orf13 contributes to cancer progression.

How does chromosome 7 gain in cancer cells affect C7orf13 expression and function?

Gain of whole chromosome 7 is an early event in gliomagenesis that occurs in proneural-like precursor cells, which ultimately give rise to all isocitrate dehydrogenase (IDH) wild-type glioblastoma transcriptional subtypes . Among the genes on chromosome 7, C7orf13 is one of the genes whose expression changes have shown the strongest association with patient survival . This suggests that chromosome 7 gain leads to increased C7orf13 expression, potentially contributing to cancer progression. While platelet-derived growth factor A (PDGFA) on chromosome 7 is known to drive gliomagenesis, research indicates that there are likely several other genes on chromosome 7, potentially including C7orf13, that select for increased whole-chromosome copy number within glioblastoma cells . The specific mechanisms by which increased C7orf13 copy number and expression contribute to cancer cell fitness advantages require further investigation.

What are the key methodological challenges in researching C7orf13's function?

Several methodological challenges exist in researching C7orf13's function:

  • Dual classification confusion: C7orf13 was initially annotated as an uncharacterized protein but is now recognized as a long non-coding RNA (LINC01006) . This dual classification may lead to confusion in experimental design and interpretation of results.

  • Limited structural information: The lack of detailed structural information about C7orf13, particularly regarding its functional RNA domains, hampers structure-based functional studies.

  • Complex regulatory networks: C7orf13 appears to be involved in complex regulatory networks involving microRNAs and downstream targets . Disentangling these interconnected pathways requires sophisticated experimental approaches and careful validation of results.

  • Cancer-specific context: C7orf13's function may be highly context-dependent, varying across different cancer types. Research has primarily focused on nasopharyngeal carcinoma and potentially glioblastoma , but its role in other cancers remains unexplored.

  • In vivo relevance: Translating in vitro findings to in vivo models and ultimately to clinical relevance presents significant challenges, particularly for molecular targets with complex regulatory functions.

What potential therapeutic applications might emerge from targeting C7orf13 in cancer?

Based on current research, several potential therapeutic applications might emerge from targeting C7orf13 in cancer:

  • RNA interference therapy: The development of siRNA or antisense oligonucleotides targeting C7orf13 could potentially suppress its oncogenic function in cancers where it is overexpressed .

  • MicroRNA mimics: Since C7orf13 functions by sequestering miR-449c and miR-28-5p , introducing mimics of these microRNAs might counteract C7orf13's effect and inhibit cancer progression.

  • Diagnostic biomarker: C7orf13 overexpression in nasopharyngeal carcinoma and its association with survival in glioblastoma suggest its potential use as a diagnostic or prognostic biomarker.

  • Combination therapy: Targeting C7orf13 in combination with conventional therapies might enhance treatment efficacy, particularly in cancers where C7orf13 contributes to therapy resistance.

  • Downstream target inhibition: Targeting downstream effectors of C7orf13, such as FMNL2 , might provide an alternative therapeutic strategy when direct targeting of C7orf13 is challenging.

How can researchers address the contradictions in C7orf13 literature regarding its classification as a protein versus non-coding RNA?

To address contradictions regarding C7orf13's classification:

  • Comprehensive transcriptomic analysis: Employing RNA-seq and ribosome profiling to definitively determine whether C7orf13 transcripts are translated into protein or function primarily as non-coding RNA.

  • Proteomic verification: Using mass spectrometry to detect potential C7orf13 protein products in various tissues and cell types, confirming or refuting its protein-coding potential.

  • Evolutionary conservation analysis: Examining the evolutionary conservation of C7orf13's open reading frame versus its RNA structure across species to infer functional significance.

  • Functional validation: Designing experiments that specifically distinguish between protein-dependent and RNA-dependent functions, such as introducing frameshift mutations that disrupt the protein sequence without affecting the RNA structure.

  • Dual-function hypothesis testing: Investigating whether C7orf13 might have dual functions, acting both as a non-coding RNA and producing a functional protein under specific cellular conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.