Recombinant Human Uncharacterized protein C7orf66 (C7orf66)

Shipped with Ice Packs
In Stock

Description

Introduction to C7orf66

C7orf66 refers to "chromosome 7 open reading frame 66," indicating that this gene is located on human chromosome 7 . The designation "open reading frame" (ORF) denotes a sequence of DNA that potentially encodes a protein. As of the latest genomic annotations, this gene has been assigned the NCBI gene ID 154907, with information last updated on September 11, 2019 .

The uncharacterized status of C7orf66 places it among numerous proteins in the human proteome whose specific biological roles remain to be fully elucidated. This presents both challenges and opportunities for researchers interested in expanding our understanding of the human genome's functional components. The protein's location on chromosome 7 provides important context for understanding its potential relationships with other genes and possible implications in human physiology or pathology.

Genetic Information

The C7orf66 gene encodes a transcript identified as NM_001024607.2 according to the NCBI database . This gene is situated on chromosome 7 of the human genome, with the corresponding protein identified by the NCBI protein ID NP_001019778.1 . In the UniProt database, this protein is assigned the identifier A4D0T2 .

Table 1: Key identifiers associated with C7orf66

DatabaseIdentifierDescription
NCBI Gene154907Human C7orf66 gene ID
NCBI TranscriptNM_001024607.2Current transcript variant
NCBI ProteinNP_001019778.1Protein identifier
UniProtA4D0T2Protein entry in UniProt
Chromosome7Genomic location

Transcript Information

The Leiden Open Variation Database (LOVD) provides transcript information for C7orf66, listing it as a gene on chromosome 7 with transcript ID NM_001024607.1 . This database tracks variants of this gene, which may have implications for understanding genetic diversity and potential functional consequences of mutations. The Broad Institute's GPP Web Portal confirms the presence of an updated transcript version NM_001024607.2 .

Suppliers and Products

The recombinant form of the C7orf66 protein is commercially available from multiple suppliers, including:

  1. CUSABIO TECHNOLOGY LLC (China): Offers the product under code CSB-CF004190HU, described as "Recombinant Human Uncharacterized protein C7orf66" .

  2. ABM: Provides "C7orf66 Protein Lysate (Human) with C-Ha Tag" under catalog number 14705031 .

Table 3: Commercial suppliers of C7orf66 products

SupplierProduct NameCatalog NumberTag Information
CUSABIO TECHNOLOGY LLCRecombinant Human Uncharacterized protein C7orf66CSB-CF004190HUN-terminal 10xHis-tag
ABMC7orf66 Protein Lysate (Human)14705031C-Ha Tag

Research Applications

While the specific functions of C7orf66 remain uncharacterized, the availability of recombinant forms of this protein enables various research applications:

Functional Studies

The recombinant protein can be used in biochemical and cellular assays to investigate potential functions. Given its transmembrane nature, studies might focus on its potential role in membrane-associated processes such as signal transduction or molecular transport. Researchers can employ various techniques including protein localization studies, functional assays, and mutational analyses to begin elucidating the biological role of this protein.

Antibody Production

Recombinant C7orf66 can serve as an immunogen for the production of antibodies, which would be valuable tools for detecting and studying the endogenous protein in various experimental contexts . The product information from CUSABIO specifically mentions "Immunogen Species: Homo sapiens (Human)," suggesting its potential use in antibody development. These antibodies could facilitate studies on protein expression patterns in different tissues and cell types.

Interaction Studies

Recombinant C7orf66 could be employed in protein-protein interaction studies to identify binding partners, potentially providing insights into its biological function. The presence of affinity tags in commercial recombinant proteins facilitates pull-down assays, co-immunoprecipitation experiments, and other interaction-based studies. Identifying the interactome of C7orf66 could provide valuable clues about its cellular functions.

RNA Interference Studies

The Broad Institute's GPP Web Portal lists shRNA constructs that match the C7orf66 gene, suggesting that RNA interference approaches have been developed to study the effects of knocking down this gene's expression . These tools would be valuable for investigating the consequences of C7orf66 deficiency in cellular models and could help establish the physiological importance of this protein.

Table 5: Potential research applications for recombinant C7orf66

ApplicationDescriptionRelevant Features
Functional StudiesInvestigation of biological activitiesTransmembrane nature suggests membrane-associated functions
Antibody ProductionDevelopment of detection toolsFull-length protein can serve as immunogen
Interaction StudiesIdentification of binding partnersRecombinant protein with tags facilitates pull-down experiments
RNA InterferenceAnalysis of loss-of-function effectsshRNA constructs available from research repositories

The Recombinant Human Uncharacterized protein C7orf66 represents an intriguing protein in the human proteome that warrants further investigation. Its transmembrane nature suggests potential roles in membrane-associated cellular processes, though its specific functions remain to be elucidated. The availability of recombinant forms of this protein from commercial suppliers enables diverse research applications aimed at understanding its biological significance.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
C7orf66; Uncharacterized protein C7orf66
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
C7orf66
Target Protein Sequence
MMAVMTPSDGLSQLSVPHLTHQRLWSLSCLAMLFQAVLILSAPQMSCLLKCFYALDPLHP VMSEEFSAQYRHMMDQRYRTRIHEGYISQVKGAYLRIVHKKPISYAKSFPKEMGN
Uniprot No.

Q&A

What is C7orf66 and why is it classified as an uncharacterized protein?

C7orf66 (Chromosome 7 Open Reading Frame 66) is a human protein-coding gene located on chromosome 7 that produces a protein whose structure and function remain largely unknown. The term "uncharacterized" indicates that despite being identified through genomic sequencing, the protein's biological role, molecular function, subcellular localization, and interaction partners have not been thoroughly defined through experimental validation.

This classification represents a significant research opportunity in the field of functional proteomics, as approximately 20% of human proteins remain uncharacterized. Recent initiatives specifically target these proteins to enhance our understanding of the complete human proteome . The characterization process typically begins with computational prediction of structural elements, followed by recombinant protein production for experimental validation of biological functions.

What expression systems are recommended for producing recombinant C7orf66 protein?

For optimal production of recombinant human C7orf66, researchers should consider multiple expression systems based on predicted protein characteristics and experimental requirements:

Expression SystemAdvantagesLimitationsRecommended Use Cases
E. coliCost-effective, high yield, rapid expressionLimited post-translational modifications, potential inclusion body formationInitial structural studies, antibody production
HEK293 cellsProper human folding and post-translational modificationsHigher cost, lower yield than bacterial systemsFunctional studies requiring authentic modifications
Insect cellsIntermediate between bacterial and mammalian systemsMore complex than bacterial expressionComplex proteins requiring certain modifications

The choice of expression system significantly impacts protein quality. For instance, when producing other signaling proteins like Sonic Hedgehog (Shh), HEK293-expressed protein with proper post-translational modifications showed over 200-fold greater activity than E. coli-produced versions . This demonstrates how critical the expression system choice is for maintaining biological activity, especially for proteins like C7orf66 whose function remains unknown.

What quality control methods should be used to verify recombinant C7orf66 protein?

A comprehensive quality control strategy for recombinant C7orf66 should incorporate multiple analytical approaches:

  • Purity Assessment: SDS-PAGE and size exclusion chromatography should demonstrate >95% purity, with results documented through gel imaging.

  • Identity Confirmation: Mass spectrometry (LC-MS/MS) to verify protein sequence and identify potential modifications. Western blotting can verify immunoreactivity if antibodies are available.

  • Endotoxin Testing: LAL (Limulus Amebocyte Lysate) assay should confirm endotoxin levels below 1.0 EU/μg protein to ensure experimental reliability .

  • Stability Analysis: Accelerated stability studies should monitor protein integrity under various storage conditions. Properly lyophilized or optimally formulated preparations are essential for maintaining activity during shipping and storage .

  • Lot-to-Lot Consistency: Each new production lot should be compared to previous standards for bioactivity, purity, and endotoxin levels to ensure experimental reproducibility .

What CRISPR-Cas9 strategies can be employed to study C7orf66 function?

CRISPR-Cas9 technology provides powerful approaches for investigating C7orf66 function through systematic genetic manipulation:

Gene Knockout Strategy:
The Broad Institute has designed specific gRNA sequences for targeting C7orf66 with minimal off-target effects . When designing knockout experiments, researchers should:

  • Select at least two different gRNA constructs to increase success probability .

  • Verify gRNA sequences against your target gene sequence, especially if targeting specific splice variants or exons .

  • Use sequence-verified plasmids containing all required elements: U6 promoter, spacer (target) sequence, gRNA scaffold, and terminator .

Key considerations for successful C7orf66 CRISPR experiments:

  • Validate knockouts through sequencing and protein expression analysis

  • Consider potential compensation by paralogous genes

  • Analyze phenotypes across multiple cellular processes

  • Implement genome-wide screens to identify genetic interactions

Researchers should note that while a single gRNA construct may be sufficient for gene knockout, using multiple guides increases the probability of successful editing and allows for validation of phenotypes across different targeting strategies .

How can post-translational modifications of C7orf66 be identified and characterized?

Post-translational modifications (PTMs) often critically determine protein function, particularly for uncharacterized proteins. A systematic approach to C7orf66 PTM analysis should include:

  • Prediction and Bioinformatic Analysis: Use computational tools to predict potential PTM sites based on sequence motifs and structural features.

  • Mass Spectrometry Analysis: Employ LC/ESI-MS to identify mass shifts characteristic of modifications. This approach successfully identified both cholesterol and fatty acid modifications on recombinant Sonic Hedgehog protein, revealing critical functional elements .

  • Site-Directed Mutagenesis: Create variants with modified potential PTM sites to assess functional consequences.

  • Functional Comparison: Compare activity of protein expressed in different systems that support varying levels of modifications. For example, with Shh protein, naturally-modified versions showed over 14-fold higher activity than versions lacking proper modifications .

The identification of PTMs may provide crucial insights into C7orf66 function, as demonstrated with other proteins where modifications were essential for proper activity and localization.

What bioinformatic approaches can predict potential functions of C7orf66?

Given the uncharacterized nature of C7orf66, bioinformatic analyses provide essential starting points for functional hypothesis generation:

Bioinformatic ApproachApplication to C7orf66Output Metrics
Sequence Homology AnalysisIdentify evolutionary relationships and potential functional conservationPercent identity, e-values, conserved domains
Structural PredictionGenerate 3D models to predict functional domainsModel confidence scores, structural similarity to known proteins
Gene Co-expression NetworksIdentify genes with similar expression patternsCorrelation coefficients, network centrality measures
Protein-Protein Interaction PredictionIdentify potential binding partnersConfidence scores, interaction probabilities
Subcellular Localization PredictionDetermine likely cellular compartmentProbability scores for different cellular locations

These computational approaches should inform experimental design rather than replace empirical testing. When applied systematically, they can significantly narrow the experimental search space and accelerate functional characterization.

How can researchers design effective antibodies for C7orf66 detection?

Developing specific antibodies for uncharacterized proteins presents unique challenges. For C7orf66, researchers should consider:

  • Epitope Selection Strategy:

    • Analyze the predicted protein structure to identify surface-exposed regions

    • Select epitopes with minimal similarity to other proteins

    • Consider multiple epitopes across the protein to increase detection probability

  • Validation Protocol:

    • Use recombinant C7orf66 as a positive control

    • Include CRISPR knockout cells as negative controls

    • Perform specificity tests including Western blotting, immunoprecipitation, and immunocytochemistry

  • Cross-Reactivity Testing:

    • Test against closest homologs to ensure specificity

    • Validate across multiple cell types and tissues

The credibility of subsequent studies depends heavily on antibody specificity, making thorough validation essential before applying antibodies to biological questions.

What data management practices should researchers follow when publishing results on uncharacterized proteins?

Research on uncharacterized proteins like C7orf66 requires rigorous data management to enable reproducibility and future extensions of the work:

  • Comprehensive Data Deposition: All data should be deposited in appropriate repositories. For uncharacterized proteins, this is particularly important as these datasets form the foundation for future studies.

  • Data Sharing Best Practices: Data sharing in research is attributed vast potential for scientific progress, allowing reproducibility of results and reuse of data for new insights . A systematic review of scholarly articles identified that academic data sharing has received increasing attention over the past decade .

  • Documentation Requirements: Document experimental protocols in detail, including expression systems, purification methods, and buffer compositions. For C7orf66, document any modifications to standard protocols required for protein stability or activity.

  • Research Data Management Plan:

Data TypeRepositoryDocumentation ElementsAccess Level
Protein sequenceUniProtSequence, predicted features, experimental evidenceOpen access
Expression constructsAddgeneVector maps, sequence files, expression protocolsAvailable upon request
Structural dataPDBExperimental methods, resolution, validation reportsOpen access
Functional dataAppropriate field-specific databaseExperimental design, raw data, analysis codeOpen access with citation requirement

Proper data management practices ensure that research on uncharacterized proteins builds a reliable foundation for the field and accelerates the pace of discovery .

What experimental approaches can identify potential binding partners of C7orf66?

Identification of interaction partners represents a critical step toward understanding the function of uncharacterized proteins:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged recombinant C7orf66 in appropriate cell lines

    • Perform pulldown experiments under physiological conditions

    • Identify binding partners through mass spectrometry

    • Validate interactions through reciprocal pulldowns

  • Proximity Labeling Methods:

    • Fuse C7orf66 to BioID or APEX2 proximity labeling enzymes

    • Allow in vivo labeling of proximal proteins

    • Identify labeled proteins through streptavidin pulldown and mass spectrometry

    • This approach captures transient interactions often missed by traditional methods

  • Yeast Two-Hybrid Screening:

    • Use C7orf66 as bait against human cDNA libraries

    • Screen for positive interactions through reporter gene activation

    • Validate interactions in mammalian systems

  • Co-localization Studies:

    • Express fluorescently tagged C7orf66 in relevant cell types

    • Perform immunofluorescence to identify co-localizing proteins

    • Confirm through super-resolution microscopy techniques

These complementary approaches provide multiple lines of evidence for potential interaction partners, addressing the challenge of identifying functions for uncharacterized proteins through their molecular associations.

How should researchers optimize storage conditions for recombinant C7orf66 protein?

Proper storage of recombinant proteins is essential for maintaining activity and experimental reproducibility:

  • Formulation Development:

    • Test various buffer compositions to identify optimal stability conditions

    • Consider additives like glycerol, reducing agents, or specific ions based on initial stability studies

    • Develop specialized formulations for optimal stability, as practiced with other recombinant proteins

  • Lyophilization Protocol:

    • If lyophilization is selected, optimize protocols to ensure complete reconstitution

    • Validate activity pre- and post-lyophilization to confirm preservation of function

    • R&D Systems and other manufacturers use lyophilization to ensure proteins reach researchers in perfect condition

  • Stability Monitoring:

    • Implement regular testing of stored protein aliquots

    • Monitor for degradation through SDS-PAGE, activity assays, and mass spectrometry

    • Establish acceptance criteria for continued use in experiments

  • Storage Recommendations:

    • For short-term storage: 4°C with appropriate stabilizers

    • For long-term storage: -80°C in small aliquots to avoid freeze-thaw cycles

    • Consider specialized storage technologies that allow refrigerator storage for up to 6 months without freezing

Careful attention to these storage considerations ensures experimental consistency and reliable results when working with sensitive recombinant proteins.

How can researchers assess the potential role of C7orf66 in disease pathways?

Investigating potential disease associations for uncharacterized proteins requires a multi-faceted approach:

  • Genetic Association Studies:

    • Analyze genome-wide association study (GWAS) data for SNPs in or near the C7orf66 locus

    • Look for altered expression in disease transcriptome datasets

    • Consider rare variant analysis in sequencing data from patient cohorts

  • Expression Profiling:

    • Compare C7orf66 expression across normal and pathological tissues

    • Analyze expression changes during disease progression

    • Correlate expression with clinical parameters

  • Functional Rescue Experiments:

    • In cellular or animal disease models, test whether C7orf66 overexpression or suppression affects disease phenotypes

    • Use CRISPR-engineered cell lines with C7orf66 knockout to assess disease-relevant cellular processes

  • Pathway Analysis:

    • Based on interaction partners and expression patterns, identify potential signaling pathways involving C7orf66

    • Test effects of C7orf66 manipulation on pathway activation using reporter assays

This systematic approach can reveal unexpected roles for uncharacterized proteins in disease mechanisms, potentially identifying new therapeutic targets.

What structural biology techniques are most appropriate for characterizing C7orf66?

Determining the structure of uncharacterized proteins presents unique challenges that can be addressed through complementary techniques:

TechniqueApplication to C7orf66Resolution RangeSample Requirements
X-ray CrystallographyHigh-resolution structural determination0.5-3ÅMilligram quantities of purified protein that forms diffracting crystals
Cryo-Electron MicroscopyStructural determination without crystallization2-4ÅMicrogram quantities of purified protein
NMR SpectroscopyDynamic structure and binding interactionsAtomic resolution for proteins <30kDaIsotopically labeled protein in milligram quantities
Small-Angle X-ray Scattering (SAXS)Low-resolution envelope, flexibility analysis10-30ÅMonodisperse protein in solution
AlphaFold2 PredictionComputational structure predictionVaries with confidenceProtein sequence only

Researchers should select techniques based on protein characteristics and specific research questions. For instance, if C7orf66 contains flexible regions or undergoes conformational changes, a combination of crystallography or Cryo-EM with SAXS or NMR might provide complementary insights into both structure and dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.