Recombinant Human Uncharacterized protein CXorf1 (CXorf1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
CXorf1; Putative transmembrane protein CXorf1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
CXorf1
Target Protein Sequence
MYSRLFYLKSSYIIYFEPLFSNAIINILSFINSLASPLTIFCFALSAQALSTIFYFRIFI FIFHSWILLFHFYFTCSFKTYEHQHSKMVPAYRMQSPRALPRTYLYVWPYK
Uniprot No.

Target Background

Database Links

OMIM: 300565

STRING: 9606.ENSP00000386149

UniGene: Hs.106688

Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Brain. In the hippocampus it is mainly localized in the granular-cell layer of the dentate gyrus and in the CA2-CA3 subfields of Ammon's horn.

Q&A

What is CXorf1 and where is it expressed?

CXorf1 (Chromosome X Open Reading Frame 1) is an uncharacterized protein encoded by an intronless gene located on the X chromosome. Northern blot analysis has revealed two distinct transcripts primarily expressed in the brain and in the G361 melanoma cell line . In situ hybridization experiments performed on human hippocampus sections have demonstrated a specific pattern of expression, with CXorf1 mRNA localized in the granular-cell layer of the dentate gyrus and in the CA2-CA3 subfields of Ammon's horn . This spatial distribution in the hippocampus suggests potential involvement in cognitive functions, though its precise role remains to be elucidated.

What is the genomic location and structure of the CXorf1 gene?

The CXorf1 gene maps to the long arm of the X chromosome at position Xq27.3, between the loci DXS369 and DXS181, approximately 2.5 Mb centromeric to the FMR1 gene . It is notable for being an intronless gene, meaning it lacks introns in its genomic structure . This characteristic is relatively uncommon in the human genome and may provide insights into its evolutionary history. Its proximity to the FMR1 gene, which is associated with Fragile X syndrome, places it near a candidate region for several X-linked mental retardation (XLMR) syndromes , making it an interesting candidate for studies investigating X-linked cognitive disorders.

In which species is CXorf1 conserved?

Comparative genomic studies have demonstrated that CXorf1 is conserved across several mammalian species, specifically in primates, cow, and horse . Interestingly, the gene is not conserved in mouse and rat models , which are commonly used laboratory animals. This pattern of conservation suggests a relatively recent evolutionary origin within certain mammalian lineages. The lack of conservation in rodents poses significant challenges for functional studies, as it limits the use of these common model organisms for investigating CXorf1 function through genetic manipulation.

What detection methods are available for studying CXorf1?

Several detection methods are available for studying CXorf1 at both the protein and nucleic acid levels:

For protein detection:

  • Immunoblotting (Western blot) using commercially available antibodies

  • Enzyme-linked immunosorbent assay (ELISA)

  • Immunohistochemistry for tissue localization studies

Commercial antibodies, such as the rabbit polyclonal antibody from Abbexa, have been developed against synthetic peptides from the C-terminal region (amino acids 62-90) of human CXorf1 . These antibodies have been validated for applications such as Western blotting (recommended dilution 1/1000) and ELISA , providing essential tools for protein-level investigations.

For nucleic acid detection:

  • Northern blot analysis for mRNA expression

  • In situ hybridization for spatial expression patterns

  • Quantitative PCR (qPCR) for measuring transcript levels

  • RNA sequencing (RNA-Seq) for comprehensive transcriptomic analysis

What is known about the function of CXorf1 in the brain?

The function of CXorf1 in the brain remains largely uncharacterized, representing a significant knowledge gap in neurobiology. Its specific expression pattern in the hippocampus, particularly in the granular-cell layer of the dentate gyrus and the CA2-CA3 subfields of Ammon's horn , suggests potential roles in hippocampal functions such as learning, memory formation, or spatial navigation.

Methodological approach for elucidating brain function:

  • Conduct electrophysiological studies on hippocampal neurons with manipulated CXorf1 expression

  • Perform calcium imaging to investigate if CXorf1 influences neuronal signaling cascades

  • Use single-cell RNA sequencing of hippocampal regions to identify co-expressed genes

  • Apply optogenetic techniques in model systems where CXorf1 orthologs exist

  • Analyze behavioral phenotypes in organisms with altered CXorf1 expression, focusing on hippocampus-dependent tasks

Given its localization pattern, researchers should consider designing experiments that specifically address potential roles in adult neurogenesis (dentate gyrus) and in the processing of information along the trisynaptic circuit of the hippocampus.

How might CXorf1 be related to X-linked mental retardation syndromes?

The genomic location of CXorf1 places it in proximity to regions associated with several X-linked mental retardation (XLMR) syndromes , making it a candidate gene of interest in these disorders. While direct evidence linking CXorf1 mutations to specific XLMR syndromes is currently lacking, its brain-specific expression pattern warrants further investigation.

Research methodology to establish potential links:

  • Perform comprehensive sequencing of CXorf1 in cohorts of patients with undiagnosed XLMR

  • Conduct association studies between CXorf1 variants and cognitive phenotypes

  • Analyze copy number variations (CNVs) encompassing the CXorf1 locus using high-resolution X chromosome-specific array-CGH

  • Use CRISPR-Cas9 gene editing to introduce XLMR-associated variants in neuronal cell models

  • Apply biochemical approaches to determine if CXorf1 interacts with known XLMR-associated proteins

What experimental approaches can be used to characterize the function of CXorf1?

Characterizing the function of uncharacterized proteins like CXorf1 requires a multi-faceted experimental approach:

Proteomic approaches:

  • Affinity purification coupled with mass spectrometry to identify protein-protein interactions

  • Proximity labeling methods (BioID, APEX) to identify proteins in the same subcellular compartment

  • Protein domain analysis through truncation mutants to map functional regions

Genetic approaches:

  • CRISPR-Cas9 knockout or knockdown studies in cell lines expressing CXorf1

  • Overexpression studies to observe gain-of-function phenotypes

  • Creation of tagged versions for localization studies and pulldown experiments

Transcriptomic approaches:

  • RNA-Seq analysis after CXorf1 manipulation to identify downstream gene expression changes

  • ChIP-Seq if CXorf1 is found to interact with chromatin or transcription factors

Systems biology approaches:

  • Network analysis to place CXorf1 in the context of known protein interaction networks

  • Pathway enrichment analysis following perturbation of CXorf1 levels using tools like PathwAX II and FunCoup

Since CXorf1 is not conserved in mice or rats , researchers might consider using human cell lines (particularly neuronal or hippocampal-derived) or exploring alternative model organisms where orthologs exist.

How can subinteractome analysis help understand CXorf1 function?

Subinteractome analysis represents a powerful approach for elucidating the possible functions of uncharacterized proteins like CXorf1:

Methodological framework:

  • Identify potential interaction partners through co-immunoprecipitation followed by mass spectrometry

  • Construct a protein-protein interaction network centered on CXorf1

  • Perform enrichment analysis of the interacting proteins to identify overrepresented biological processes and pathways

  • Compare the CXorf1 subinteractome with those of proteins of known function

A similar approach has been applied to other uncharacterized chromosome-specific open-reading frame (CxORFx) proteins, revealing associations with cancer-driven cellular processes . The subinteractome of each ORF protein can be constructed using multiple data sources on physical protein-protein interactions (PPIs), allowing researchers to explore possible cellular functions through the spectrum of neighboring annotated protein partners .

Analysis TypeRecommended ToolsKey ParametersOutput Interpretation
PPI Network ConstructionFunCoup, CancerGeneNetConfidence score threshold ≥ 0.7First and second-degree interactions
Functional EnrichmentEnrichR, WebGestaltFDR < 0.05Overrepresented GO terms and pathways
Network VisualizationCytoscapeBetweenness centrality, degreeHub proteins, network modules
Expression CorrelationGEPIA2, KMplotterPearson correlation r > 0.4Co-expressed gene clusters

This methodological approach can help place CXorf1 in the context of known biological pathways and provide testable hypotheses about its function.

What challenges are associated with studying uncharacterized proteins like CXorf1?

Investigating uncharacterized proteins presents several unique challenges:

  • Limited prior knowledge

    • Absence of established protocols specific to the protein

    • Lack of validated reagents and tools

    • Few reference points for experimental design

  • Evolutionary constraints

    • CXorf1's absence in common model organisms (mice and rats) limits traditional in vivo approaches

    • Necessitates work in less well-established model systems or human cell lines

  • Technical challenges

    • Potential expression issues with recombinant protein production

    • Difficulty in raising highly specific antibodies against proteins with unknown structures

    • Uncertainty about post-translational modifications

  • Functional characterization obstacles

    • No known interacting partners to guide initial studies

    • Unclear subcellular localization beyond membrane association

    • Unknown regulatory mechanisms governing expression

Methodological strategies to overcome these challenges:

  • Apply unbiased screening approaches (e.g., yeast two-hybrid, BioID)

  • Utilize comparative genomics across species where CXorf1 is conserved (primates, cow, horse)

  • Employ systems biology techniques like those used for other CxORFx proteins

  • Develop multiple independent detection methods to confirm observations

  • Consider emerging technologies such as AlphaFold for structural predictions

What are the considerations for experimental validation of CXorf1 function in cellular models?

When designing experiments to validate CXorf1 function in cellular models, researchers should consider the following methodological approaches:

  • Selection of appropriate cellular models:

    • Human neuronal cell lines or primary cultures derived from hippocampus

    • Patient-derived induced pluripotent stem cells (iPSCs) differentiated into neurons

    • Non-human primate cellular models (given conservation pattern)

  • Gene manipulation strategies:

    • CRISPR-Cas9 knockout: Complete removal of CXorf1 to assess loss-of-function effects

    • RNA interference: Partial knockdown to examine dose-dependent effects

    • Inducible expression systems: Temporal control of CXorf1 expression

    • Domain-specific mutations: Targeting predicted functional motifs

  • Phenotypic assays:

    • Morphological analysis: Changes in neuronal structure, dendritic spine formation

    • Electrophysiological recordings: Alterations in neuronal firing patterns

    • Calcium imaging: Assessment of neuronal signaling dynamics

    • Synapse formation and function: Immunostaining for synaptic markers

  • Molecular validation:

    • Western blotting with validated antibodies (e.g., Abbexa anti-CXorf1)

    • Immunofluorescence for subcellular localization

    • qRT-PCR for expression analysis across developmental stages

    • Co-immunoprecipitation to confirm predicted protein interactions

  • Data analysis:

    • Statistical comparison between experimental and control conditions

    • Integration of multiple assays to build a comprehensive functional profile

    • Correlation with existing datasets from similar brain-expressed proteins

How can transcriptomic analysis reveal potential roles of CXorf1 in neuronal function?

Transcriptomic approaches offer powerful insights into the functional role of uncharacterized proteins by examining the broader cellular context of their expression and the consequences of their manipulation.

Methodological framework for transcriptomic investigation of CXorf1:

  • Expression correlation analysis

    • Analyze co-expression patterns across diverse brain regions and cell types

    • Identify genes with similar expression profiles to CXorf1, particularly in hippocampal regions

    • Apply weighted gene co-expression network analysis (WGCNA) to place CXorf1 in functional modules

  • Perturbation-based transcriptomics

    • Perform RNA-Seq after CXorf1 knockdown or overexpression in relevant cell types

    • Identify differentially expressed genes (DEGs) using appropriate statistical tools

    • Conduct time-course experiments to distinguish primary from secondary effects

  • Single-cell RNA-Seq applications

    • Characterize the exact cell populations expressing CXorf1 in hippocampal tissue

    • Examine cell-type-specific responses to CXorf1 manipulation

    • Identify potential cell-autonomous versus non-cell-autonomous effects

  • Analysis pipeline for transcriptomic data:

    • Gene Ontology (GO) enrichment analysis of DEGs using tools like EnrichR

    • Pathway analysis using tools like WebGestalt and PathwAX II

    • Transcription factor binding site analysis to identify potential regulatory mechanisms

    • Integration with publicly available brain transcriptome datasets

Example of expected results from transcriptomic analysis:

Analysis TypeTop Enriched TermsEnrichment Scorep-valueSource
GO: Biological ProcessNeuronal development, Synapse organization2.43, 2.170.003, 0.007WebGestalt
GO: Cellular ComponentPostsynaptic density, Dendritic spine3.12, 2.980.001, 0.002EnrichR
GO: Molecular FunctionProtein binding, Ion channel binding1.87, 1.650.012, 0.028WebGestalt
KEGG PathwayLong-term potentiation, Glutamatergic synapse2.76, 2.520.004, 0.009PathwAX II

This hypothetical data table represents the type of results that might be generated from transcriptomic analysis following CXorf1 perturbation, highlighting potential biological processes that CXorf1 might influence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.