Recombinant Human Uncharacterized protein KIAA1467 (KIAA1467)

Shipped with Ice Packs
In Stock

Description

Introduction to KIAA1467

KIAA1467 is a human protein-coding gene that produces what is currently classified as an uncharacterized protein . The designation "uncharacterized" indicates that the precise biological function of this protein has not yet been fully determined through experimental validation . The protein is also known by the alternative name FAM234B (family with sequence similarity 234 member B), suggesting its potential relationship to other proteins within the same family grouping .

Recombinant Human Uncharacterized protein KIAA1467 refers specifically to artificially produced versions of this protein created through various expression systems for research and characterization purposes. These recombinant versions enable scientists to study the protein's properties, interactions, and potential functions in controlled laboratory settings despite its endogenous function remaining undetermined .

Protein Structure and Classification

KIAA1467 is classified as a member of the FAM234 family of proteins, specifically member B (FAM234B) . While the detailed three-dimensional structure of the protein has not been extensively characterized in the available literature, recombinant versions are produced and purified to high standards, suggesting the protein possesses stable structural characteristics amenable to in vitro production and analysis .

Expression Systems

Recombinant Human Uncharacterized protein KIAA1467 can be produced through several different expression systems, each offering particular advantages for protein production. The available expression systems include:

Expression HostAdvantagesTypical Applications
E. coliHigh yield, cost-effective, rapid productionBasic biochemical studies, antibody production
YeastPost-translational modifications, higher eukaryotic systemFunctional studies requiring some modifications
BaculovirusComplex eukaryotic modifications, high yieldStructural studies, functional assays
Mammalian CellFull range of human-like post-translational modificationsStudies requiring native-like protein structure
Cell-Free ExpressionRapid production, avoids cellular toxicity issuesQuick screening, structural studies

As documented in commercial product listings, recombinant KIAA1467 has been successfully produced in each of these expression systems, with purity levels consistently reaching or exceeding 85% as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) .

Purification and Quality Control

Recombinant KIAA1467 protein undergoes rigorous purification processes to ensure high quality for research applications. The standard purity level for commercial preparations is greater than or equal to 85% as determined by SDS-PAGE analysis . This analytical technique separates proteins based on their molecular weight, allowing for the assessment of sample purity and the identification of potential contaminants.

For antibodies developed against KIAA1467, even higher purity standards are implemented, with protein G purification resulting in preparations exceeding 95% purity . These high-purity preparations are essential for applications requiring specific detection of the target protein without cross-reactivity or background interference.

Available Research Reagents

A variety of research reagents targeting KIAA1467 have been developed to facilitate its study. The primary categories include:

  1. Recombinant Proteins:

    • Full-length human KIAA1467 recombinant protein

    • Partial human KIAA1467 recombinant protein

    • Homologous proteins from other species (chicken, mouse)

  2. Antibodies:

    • Unconjugated anti-KIAA1467 antibodies

    • Conjugated antibodies with various detection tags:

      • Biotin-conjugated anti-KIAA1467

      • Horseradish peroxidase (HRP)-conjugated anti-KIAA1467

      • Fluorescein isothiocyanate (FITC)-conjugated anti-KIAA1467

These reagents provide critical tools for researchers investigating the expression, localization, and function of KIAA1467 in various experimental systems.

Experimental Applications

The available antibodies against KIAA1467 have been validated for multiple experimental applications, enabling diverse approaches to studying this protein. These applications include:

ApplicationDescriptionInformation Provided
ELISA (EIA)Quantitative detection of KIAA1467 in solutionProtein concentration, presence in samples
Western Blot (WB)Detection of denatured protein by sizeMolecular weight, expression levels
Immunohistochemistry (IHC)Detection in fixed tissue sectionsTissue distribution, cellular localization
Immunofluorescence (IF)Fluorescent detection in cells/tissuesSubcellular localization, co-localization studies

These experimental techniques provide complementary approaches to investigating KIAA1467 expression, allowing researchers to examine its presence at the protein level across different biological contexts .

Potential Pathway Interactions

While the specific function of KIAA1467 remains uncharacterized, research into compounds that can indirectly activate its function suggests potential involvement in established signaling networks. These interactions may provide clues about the protein's physiological role and regulatory mechanisms .

KIAA1467 appears to be influenced by signaling cascades involving cyclic adenosine monophosphate (cAMP) and protein kinase pathways. Specific compounds that can indirectly enhance KIAA1467 activity operate through these established cellular signaling mechanisms, suggesting the protein may function within these regulatory networks .

Identified Activators

Several compounds have been identified as potential indirect activators of KIAA1467 function through their effects on interconnected signaling pathways:

ActivatorPrimary TargetMechanismPotential Effect on KIAA1467
ForskolinAdenylate cyclaseIncreases cAMP levels, enhancing PKA activityIndirect activation through PKA-dependent pathways
PMA (Phorbol 12-myristate 13-acetate)Protein Kinase C (PKC)Activates PKC, involved in numerous signaling pathwaysIndirect influence through PKC-mediated signaling networks
SB 203580p38 MAPKInhibits p38 MAPK pathwayMay enhance KIAA1467 activity through compensatory mechanisms

The identification of these indirect activators provides valuable insights into the potential regulatory networks governing KIAA1467 function, suggesting it may be influenced by or participate in PKA and PKC signaling pathways .

Species Homologs

KIAA1467 appears to be conserved across multiple species, suggesting important biological functions that have been maintained throughout evolution. Homologs of the human KIAA1467 protein have been identified in several other species:

  1. Mouse: Identified as Kiaa1467 (alternative names: Fam234b, mKIAA1467, 8430419L09Rik)

  2. Chicken: Referenced as "Uncharacterized protein KIAA1467 homolog" (gene identifier: RCJMB04_14d19)

  3. Adelie penguin (Pygoscelis adeliae): Classified as "family with sequence similarity 234 member B"

The conservation of this protein across diverse vertebrate species suggests it may play a fundamental biological role that has been maintained through evolutionary history, despite its specific function remaining uncharacterized in current research literature.

Sequence Characteristics

The Adelie penguin homolog of KIAA1467 features an open reading frame (ORF) sequence of 1836 base pairs, encoding the protein-coding region . While detailed sequence comparisons between human KIAA1467 and its homologs in other species are not explicitly provided in the available search results, the consistent classification of these proteins within the FAM234B family suggests significant sequence similarity and likely functional conservation across species.

This evolutionary conservation provides an important context for understanding the potential significance of KIAA1467, as proteins maintained across diverse species often perform essential cellular functions that have been selected for throughout evolutionary history.

Research Limitations

Despite the commercial availability of recombinant KIAA1467 and related research tools, the protein remains classified as "uncharacterized," indicating significant gaps in our understanding of its biological function . This classification reflects the current limitations in research regarding:

  1. Precise biological function and physiological role

  2. Detailed structural characterization

  3. Comprehensive tissue expression patterns

  4. Direct interaction partners and regulatory mechanisms

  5. Involvement in specific disease processes or cellular pathways

These knowledge gaps represent important opportunities for future research to elucidate the functions of this evolutionarily conserved protein.

Future Research Directions

Based on the available information, several promising research directions could advance our understanding of KIAA1467:

  1. Functional characterization through gene editing and knockdown studies

  2. Detailed structural analysis using crystallography or cryo-electron microscopy

  3. Protein interaction studies to identify binding partners

  4. Investigation of tissue-specific expression patterns and regulation

  5. Exploration of the signaling pathways influenced by the indirect activators

  6. Comparative studies across species to identify conserved functional domains

The availability of recombinant proteins and specific antibodies provides essential tools to support these research directions , while the identified indirect activators offer potential experimental approaches for modulating KIAA1467 activity in functional studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipping, please contact us in advance as an additional fee will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is selected during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
FAM234B; KIAA1467; Protein FAM234B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-622
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
FAM234B
Target Protein Sequence
MATVLSRALKLPGKKSPDLGEYDPLTQADSDESEDDLVLNLQKNGGVKNGKSPLGEAPEP DSDAEVAEAAKPHLSEVTTEGYPSEPLGGLEQKAASSLVSYVRTSVFLLTLGISMILVLL CAFLIPCPPRDLHSTWSRHLGSQGGGDLSPLELADVNGDGLRDVLLSFVMSRNGSAVGVS RPAANLVCLSGMNGSTLWSSLLPEEARDITCLELMPGSLAETICLVTGTHKMLSAFNATS GKAIWTLNPNYLSNGTLAAPVVVLPDLDEDGVRDLVVLAIGELQPDLCFLLVSGRTGNPV GRPVKYNIVGVGNLIGPQVYITTNGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSLQI EEPEWEKRRSINLSELIDVYSDGVELLQMVKAPDSNCSNLLITTRQSLVLLRGQNLTPYW ALRLQGLRSQPTPGYFTDDQTLDFLLQIQDGVGMKKMMVVDGDSGSIVWSYRAPCHMKET PATSAVTSDQKSVFLFWAEGLSAASPNSDIILGTEPPSLHHLYLLHPAFPSILLDLANTT GTVTASEVGINDLWKDAFYVTRTTGPSSEGHPAALVVSKLSLRWALMEGQMAQLQESTPK IGRGELRRFLSRIKFVEAPYEI
Uniprot No.

Target Background

Database Links

HGNC: 29288

OMIM: 617837

KEGG: hsa:57613

STRING: 9606.ENSP00000197268

UniGene: Hs.132660

Protein Families
FAM234 family
Subcellular Location
Membrane; Single-pass membrane protein. Golgi outpost. Cytoplasm, cytoskeleton, microtubule organizing center.

Q&A

What is KIAA1467 and how is it officially designated in genomic databases?

KIAA1467 is the historical designation for a protein now officially known as FAM234B (family with sequence similarity 234 member B). It is a protein-coding gene that remains relatively uncharacterized in terms of its complete biological function. The gene has been assigned Gene ID 57613 in the NCBI database, with the most recent update recorded on March 26, 2025 . When designing experiments or searching literature, researchers should use both designations (KIAA1467 and FAM234B) to ensure comprehensive coverage, as older literature may exclusively reference the KIAA1467 designation while newer publications likely use the FAM234B nomenclature. This dual designation approach is particularly important when conducting systematic reviews or meta-analyses of existing research on this protein.

What is the genomic context of KIAA1467/FAM234B?

KIAA1467/FAM234B is located on the short arm of chromosome 12 at position p13.1 (12p13.1). The precise genomic coordinates in the current human genome assembly (NC_000012.12) are 13044381 to 13083449 . The gene contains 13 exons, making it a moderately complex gene structure. When designing primers for genomic PCR or CRISPR-Cas9 targeting strategies, researchers should account for this multi-exonic structure and consider the potential for alternative splicing. The genomic context may influence regulatory elements controlling expression; therefore, when studying transcriptional regulation, consider examining the flanking regions for potential promoter elements and transcription factor binding sites.

What is the predicted subcellular localization of KIAA1467/FAM234B protein?

Based on recent computational predictions, KIAA1467/FAM234B is likely localized to three main subcellular compartments: the Golgi apparatus, cellular membranes, and the microtubule organizing center . This predicted localization pattern suggests potential involvement in protein trafficking, membrane dynamics, or cytoskeletal organization. When designing immunocytochemistry experiments, researchers should optimize protocols for these subcellular compartments, potentially using markers such as GM130 (Golgi), Na+/K+-ATPase (plasma membrane), or γ-tubulin (centrosome/MTOC) as co-localization references. Differential centrifugation and subcellular fractionation approaches would be valuable for biochemical validation of these localization predictions.

What is the basic molecular structure of recombinant KIAA1467/FAM234B?

The open reading frame (ORF) of human KIAA1467/FAM234B consists of 1866 base pairs , which corresponds to a protein of approximately 622 amino acids. While the complete three-dimensional structure has not been definitively resolved, bioinformatic analyses suggest domain organizations that may inform functional studies. When working with recombinant systems, researchers should note that commercially available clones typically contain the full ORF, such as the expression-ready lentiviral construct that incorporates a mGFP tag for visualization and tracking . When designing truncation constructs to study domain-specific functions, careful consideration of predicted domain boundaries will be essential to avoid disrupting functional elements.

What expression systems are recommended for producing recombinant KIAA1467/FAM234B?

For mammalian expression, lentiviral vector systems have proven effective for KIAA1467/FAM234B expression. Commercially available constructs such as the pLenti-C-mGFP-P2A-Puro vector system offer several advantages :

Vector FeatureResearch BenefitMethodological Consideration
mGFP TagVisualization of protein localization and traffickingC-terminal tag may affect localization; verify with untagged construct
P2A-PuroSelection marker for stable cell line generationMaintain puromycin at optimal concentration (cell line dependent)
Lentiviral deliveryHigh transduction efficiency in diverse cell typesRequires BSL-2 safety practices; consider non-viral alternatives for sensitive applications

For biochemical studies requiring larger protein quantities, bacterial or insect cell expression systems may be considered, though careful optimization of codon usage and potential inclusion of solubility-enhancing tags (MBP, SUMO) may be necessary due to the membrane association properties of the protein.

What are the recommended approaches for detecting endogenous KIAA1467/FAM234B?

Given the limited characterization of this protein, a multi-pronged approach is recommended:

  • Transcript Detection: Design qRT-PCR primers spanning exon-exon junctions, preferably across exons that are conserved across potential splice variants. Consider RNAscope for spatial transcript detection in tissue sections.

  • Protein Detection: Commercial antibodies should be rigorously validated using positive controls (overexpression systems) and negative controls (CRISPR knockout cells). Western blotting protocols should be optimized for membrane proteins, potentially incorporating specialized detergents (CHAPS, DDM) for efficient extraction.

  • Functional Assays: Since KIAA1467/FAM234B is predicted to localize to the Golgi and membrane compartments, consider trafficking assays such as RUSH (Retention Using Selective Hooks) to study its dynamics in living cells.

How should researchers approach KIAA1467/FAM234B clone reconstitution and validation?

When working with commercially available clones like the RC206342L4 construct , proper reconstitution and validation are critical:

  • Reconstitution Protocol:

    • Centrifuge the dried plasmid at 5,000×g for 5 minutes

    • Add 100 μl of sterile water and incubate for 10 minutes at room temperature

    • Briefly vortex and perform a quick spin to concentrate the solution

    • Store reconstituted plasmid at -20°C where it remains stable for at least one year

  • Validation Steps:

    • Restriction enzyme digestion to confirm vector integrity

    • Sanger sequencing of the insert to verify sequence fidelity

    • Protein expression verification via Western blot and fluorescence microscopy (for GFP-tagged constructs)

    • Functional validation relevant to predicted localization (Golgi/membrane trafficking assays)

For sterile applications, filtration with a 0.22 μm filter is recommended as commercial plasmid preparations are not guaranteed sterile .

What approaches are recommended for investigating potential KIAA1467/FAM234B interaction partners?

Given the predicted localization to multiple cellular compartments, a combination of approaches is recommended:

  • Proximity-Based Methods:

    • BioID or TurboID fusion constructs for proximity labeling in living cells

    • APEX2 fusion for electron microscopy-compatible proximity labeling

    • These approaches are particularly valuable for membrane-associated proteins where traditional co-IP methods may be challenging

  • Co-Immunoprecipitation Strategies:

    • Crosslinking protocols optimized for membrane proteins (DSP, DTSSP)

    • Detergent optimization panel to maintain protein-protein interactions while solubilizing membrane components

    • Sequential co-IP for complex isolation and analysis

  • Functional Validation:

    • FRET/BRET for direct interaction monitoring in living cells

    • Colocalization studies with super-resolution microscopy

    • Functional rescue experiments in knockout backgrounds

What genetic approaches can be used to study KIAA1467/FAM234B function?

  • CRISPR-Cas9 Gene Editing:

    • Design multiple guide RNAs targeting early exons to ensure functional knockout

    • Consider conditional knockout strategies (floxed alleles) if constitutive knockout proves lethal

    • For precise modification, HDR templates can introduce specific mutations or tags at endogenous loci

  • RNAi Approaches:

    • siRNA pools targeting different regions to minimize off-target effects

    • shRNA for stable knockdown studies with appropriate non-targeting controls

    • Consider inducible systems for temporal control of knockdown

  • Overexpression Studies:

    • Wild-type overexpression to identify gain-of-function phenotypes

    • Domain deletion/mutation studies to identify functional regions

    • Expression of orthologous proteins for evolutionary conservation studies

What are the considerations for investigating KIAA1467/FAM234B variants?

Given that KIAA1467/FAM234B is listed in variation databases such as ClinVar and dbVar , systematic analysis of variants is an important research direction:

ResourceApplicationMethodological Approach
ClinVarIdentification of clinically significant variantsGenotype-phenotype correlation studies; functional validation of variants
dbVarStructural variation analysisPCR, MLPA, or NGS approaches to validate CNVs
Variation ViewerComprehensive variant visualizationIn silico prediction of variant effects; prioritization for functional studies

When investigating variants, researchers should consider:

  • Frequency in population databases (gnomAD, 1000 Genomes)

  • Conservation across species (PhyloP, GERP scores)

  • Predicted functional impact (SIFT, PolyPhen, CADD)

  • Location within predicted functional domains

  • Experimental validation of variants of uncertain significance

What cellular pathways might KIAA1467/FAM234B participate in based on its predicted localization?

The predicted localization of KIAA1467/FAM234B to the Golgi apparatus, membrane compartments, and microtubule organizing center suggests potential involvement in several fundamental cellular processes:

  • Protein Trafficking:

    • Secretory pathway transport (ER-to-Golgi or Golgi-to-plasma membrane)

    • Endocytic recycling pathways

    • Experimental approaches: RUSH system trafficking assays, FRAP studies, cargo transport assays

  • Membrane Dynamics:

    • Membrane curvature generation or sensing

    • Membrane fusion or fission events

    • Experimental approaches: Liposome binding assays, membrane remodeling assays, reconstitution in GUVs

  • Cytoskeletal Organization:

    • Microtubule nucleation or anchoring

    • Centrosome function during cell division

    • Experimental approaches: Microtubule regrowth assays, centrosome duplication studies, live-cell imaging during mitosis

How should researchers approach tissue-specific expression analysis of KIAA1467/FAM234B?

A comprehensive tissue expression profiling strategy should incorporate:

  • Transcript-Level Analysis:

    • Bulk RNA-seq across multiple tissues/cell types

    • Single-cell RNA-seq for cellular resolution

    • Spatial transcriptomics for regional expression patterns

  • Protein-Level Analysis:

    • Immunohistochemistry with validated antibodies

    • Tissue microarrays for high-throughput screening

    • Tissue proteomics with enrichment for membrane fractions

  • Functional Analysis:

    • Tissue-specific conditional knockout models

    • Cell type-specific expression manipulation (Cre-LoxP systems)

    • Organoid models for developmental expression studies

What evolutionary considerations are relevant for KIAA1467/FAM234B research?

Understanding the evolutionary context of KIAA1467/FAM234B can provide valuable insights into its fundamental functions:

  • Ortholog Identification:

    • Search for orthologs across model organisms (mouse, zebrafish, Drosophila, C. elegans)

    • Phylogenetic analysis to determine evolutionary conservation

    • Domain conservation analysis across species

  • Functional Conservation Testing:

    • Cross-species complementation studies

    • Domain swapping experiments between orthologs

    • Comparative localization studies in different model systems

  • Evolutionary Rate Analysis:

    • dN/dS ratios to identify selection pressures

    • Identification of rapidly evolving regions vs. constrained domains

    • Correlation with species-specific adaptations or functions

What are promising methodological advances for studying uncharacterized proteins like KIAA1467/FAM234B?

Several cutting-edge approaches show particular promise for advancing understanding of proteins like KIAA1467/FAM234B:

  • Structural Biology Approaches:

    • Cryo-EM for membrane protein structures

    • AlphaFold2/RoseTTAFold predictions combined with experimental validation

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural insights

  • Functional Genomics:

    • Genome-wide CRISPR screens to identify genetic interactions

    • Systematic interactome mapping using approaches like BioID-MS

    • Pooled CRISPR activation/inhibition screens for pathway placement

  • Advanced Imaging:

    • Live-cell super-resolution microscopy for dynamic localization studies

    • Lattice light-sheet microscopy for extended live imaging with minimal phototoxicity

    • Correlative light and electron microscopy for ultrastructural context

How can researchers systematically address the function of uncharacterized proteins like KIAA1467/FAM234B?

A systematic functional discovery workflow might include:

  • Initial Characterization Phase:

    • Definitive subcellular localization

    • Expression profiling across tissues/conditions

    • Preliminary phenotypic analysis of knockout/knockdown

  • Mechanistic Investigation Phase:

    • Comprehensive interactome mapping

    • Structure-function relationship studies

    • Conditional/tissue-specific manipulation

  • Physiological Relevance Phase:

    • Model organism studies

    • Disease-relevant contexts

    • Integration with systems-level data

When publishing findings on uncharacterized proteins, researchers should consider contributing to community resources like ProteomeXchange, the Human Protein Atlas, and appropriate model organism databases to accelerate collective understanding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.