Recombinant Human Uncharacterized protein LOC339524

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes to ensure fulfillment of your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request with an additional fee; please contact us in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Target Protein Sequence
MLARRDLGLVPHGVSGVSIAASSTPQGQAVCSPSVAAPSTLLLLRTHLLGAASLQGCGVL HILPIFLFSKGCRRDAQCACTVGPSASPRSGRGPGRGGGRRPRLGAARSGCPGAAAAGGP AVLHPWRRAGGRVRGASPPQGPQTARGFPLPSRWSSSPIPGCISIYPSPISFAHPGSLAP LGSPFPSPGPPSRSRLLCPGLRRGLTPGRWFRPDLGSLVTPRLLPLPNSGEPGIKPCAFL FFLLRAESTLHVCQGISSESERRTRSFFFFPRSCLL
Uniprot No.

Q&A

Advanced Research Questions

  • How can high-throughput protein characterization methods be applied to study LOC339524?

High-throughput approaches offer powerful strategies for characterizing uncharacterized proteins:

Mass Spectrometry-Based Approaches:

  • Shotgun proteomics for detection and expression level quantification

  • Targeted proteomics (SRM/MRM) for quantitative analysis across different conditions

  • PTM mapping for identification of regulatory modifications

  • Crosslinking mass spectrometry for structural insights

Functional Genomics Integration:

  • CRISPR-Cas9 knockout/knockdown followed by phenotypic profiling

  • Transcriptome analysis after perturbation of LOC339524 expression

  • Proteome-wide interaction studies using BioID or proximity labeling

Recent studies have demonstrated the power of untargeted proteomic approaches with LC-MS/MS for identifying novel functional peptides, such as placenta-derived peptides that can bind to TGF-β1 and impact signaling pathways . Similar approaches could reveal functional interactions of LOC339524 within cellular contexts.

  • What strategies can researchers use to investigate LOC339524's potential role in gene regulation networks?

Understanding how uncharacterized proteins fit into gene regulation networks requires sophisticated analytical approaches:

Network Construction Methods:

  • Co-expression analysis using RNA-seq data from multiple tissues/conditions

  • Chromatin immunoprecipitation (if nuclear localization is established)

  • Modulator identification algorithms to detect systemic regulatory impact

Researchers have developed unified mathematical descriptions and algorithms for detecting network modulators with significant systemic impact . These methods could be applied to understand if LOC339524 functions as a modulator within specific cellular networks.

The concept of network modulation can be extended to emerging RNA regulation mechanisms, such as competitive endogenous RNA (ceRNA), providing a framework to explore potential regulatory roles of LOC339524 . Experimental validation of computationally predicted network involvement typically requires:

  • Perturbation of LOC339524 expression followed by transcriptome analysis

  • Assessment of specific pathway components' activity

  • Promoter-reporter assays if transcriptional regulation is suspected

  • How should researchers design experiments to validate predicted functions of LOC339524?

Designing robust validation experiments for uncharacterized proteins requires systematic approaches:

Validation Framework:

Validation LevelExperimental ApproachControl Considerations
Expression ValidationqPCR, western blot, IHCTissue/cell specificity, antibody validation
Localization ConfirmationFluorescent tagging, subcellular fractionationTag interference controls, multiple methodology confirmation
Interaction VerificationCo-IP, proximity ligation assay, FRETNon-specific binding controls, reciprocal confirmation
Functional TestingActivity assays, phenotypic rescue, domain mutagenesisDomain-specific mutations, dose-dependency
Physiological RelevanceAnimal models, patient samples, disease correlationAppropriate disease models, statistical power
  • What are the common challenges in studying uncharacterized proteins like LOC339524?

Researchers face several significant challenges when investigating uncharacterized proteins:

Technical Challenges:

  • Limited availability of specific antibodies for detection and functional studies

  • Difficulty in establishing physiological relevance without known function

  • Potential issues with protein solubility or stability

  • Uncertainty about relevant experimental conditions

Analytical Challenges:

  • Distinguishing true functions from experimental artifacts

  • Establishing appropriate positive and negative controls

  • Interpreting contradictory results from different methodologies

  • Determining biological vs. statistical significance

The high number of uncharacterized proteins in the human proteome presents a significant research challenge. Despite progress in the Human Proteome Project, hundreds to thousands of canonical and non-canonical protein isoforms remain functionally uncharacterized . This has led to dedicated research initiatives focused specifically on characterizing these proteins, including the Research Topic "Characterizing the uncharacterized human proteins" .

  • How can researchers integrate multi-omics data to understand LOC339524 function?

Multi-omics integration provides powerful insights into uncharacterized protein function:

Integration Strategies:

Data TypeContribution to Functional UnderstandingIntegration Method
GenomicsGenetic variants, evolutionary conservationGWAS correlation, conservation analysis
TranscriptomicsExpression patterns, co-regulated genesRNA-seq, co-expression network analysis
ProteomicsProtein levels, PTMs, interactionsMass spectrometry, interactome analysis
MetabolomicsMetabolic pathway involvementMetabolite profiling after perturbation
PhenomicsPhenotypic effects of perturbationHigh-content screening, functional assays

Research has demonstrated the value of translatome sequencing in investigating alternative splicing isoforms, with one study identifying 50 novel protein isoforms in hepatocellular carcinoma through integration of sequencing and mass spectrometry data . Similar approaches could reveal functional aspects of LOC339524.

The concept of network modulation can be extended to integrate multiple data types, as demonstrated in studies applying these approaches to discover novel gene regulation mechanisms . For LOC339524, this might involve constructing networks based on multiple data types and analyzing how the protein modulates these networks under different conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.