Recombinant Human Uncharacterized protein ZMYM6NB (ZMYM6NB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM35B; ZMYM6NB; Transmembrane protein 35B; ZMYM6 neighbor protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-154
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
TMEM35B
Target Protein Sequence
KLSEEISAPVSERMNALFVQFAEVFPLKVFGYQPDPLNYQIAVGFLELLAGLLLVMGPPM LQEISNLFLILLMMGAIFTLAALKESLSTCIPAIVCLGFLLLLNVGQLLAQTKKVVRPTR KKTLSTFKESWK
Uniprot No.

Target Background

Database Links

HGNC: 40021

KEGG: hsa:100506144

UniGene: Hs.533986

Protein Families
DoxX family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ZMYM6NB and which protein family does it belong to?

ZMYM6NB (Zinc Finger MYM-Type Containing 6 Neighbor) is a human protein that belongs to the zinc finger protein family. While it remains largely uncharacterized, its classification within the zinc finger family suggests potential roles in nucleic acid binding, transcriptional regulation, or protein-protein interactions. As evident from the available recombinant protein data, ZMYM6NB contains an amino acid sequence "LAQTKKVVRPTRKKTLSTFKESWK" that may be functionally significant . Like other zinc finger proteins such as ZMYM3, it may have cellular functions related to chromatin interactions and DNA-associated processes, though direct evidence for ZMYM6NB specifically is still limited.

How can I obtain recombinant ZMYM6NB for my research?

Recombinant ZMYM6NB protein is available as a recombinant protein antigen from commercial sources. The protein is typically expressed in E. coli expression systems with an N-terminal His6ABP fusion tag (ABP is an Albumin Binding Protein derived from Streptococcal Protein G) . The protein is purified using IMAC (Immobilized Metal Affinity Chromatography) with expected concentrations greater than 0.5 mg/ml . When ordering this protein, it's important to review the current lot information regarding availability and specific concentration by contacting technical support at the supplier.

What is the difference between ZMYM6NB and other ZMYM family proteins?

While ZMYM6NB remains relatively uncharacterized compared to other ZMYM family members, we can draw comparisons based on the available information on related proteins such as ZMYM3. Unlike ZMYM3, which contains 10 tandem ZNF domains and a DUF3504 domain with established roles in the DNA damage response and chromatin interaction , ZMYM6NB has a simpler structure. ZMYM3 has been shown to interact with chromatin through its N-terminal region and associates with H2A/H2AX . Whether ZMYM6NB shares these properties remains to be determined through directed research. The functional differences between ZMYM family members likely relate to their structural differences and specific interaction partners.

How should I design experiments to investigate ZMYM6NB's potential role in DNA damage response?

Based on findings with related zinc finger proteins like ZMYM3, which has demonstrated involvement in DNA damage response , a comprehensive experimental design for investigating ZMYM6NB's potential role should include:

  • Localization studies: Use GFP-tagged ZMYM6NB to assess its recruitment to DNA damage sites induced by laser microirradiation or radiomimetic drugs.

  • Interaction analysis: Perform co-immunoprecipitation experiments to identify potential binding partners, particularly focusing on chromatin components such as histones (H2A/H2AX) as seen with ZMYM3 .

  • Functional assays: Utilize CRISPR-Cas9 to generate ZMYM6NB knockout cell lines and assess their sensitivity to DNA-damaging agents, cell cycle checkpoint regulation, and persistence of DNA damage markers (e.g., γH2AX) .

  • Domain mapping: Create deletion mutants of ZMYM6NB to identify regions responsible for potential chromatin interactions or damage recruitment, similar to analyses performed for ZMYM3 .

This design should utilize a within-subjects approach where applicable to reduce variability and maximize statistical power from your experimental data .

What controls should be included when assessing ZMYM6NB function in cellular experiments?

When designing experiments to investigate ZMYM6NB function, include the following controls:

  • Positive controls: Include well-characterized proteins with established functions in your pathway of interest. For DNA damage studies, include proteins like ZMYM3 or RSF1, which are known to be recruited to DNA damage sites .

  • Negative controls: Include proteins that are not expected to be involved in your pathway of interest.

  • Expression controls: For overexpression studies, include controls expressing the tag alone (e.g., GFP, His-tag) to account for tag-related effects.

  • Knockout/knockdown validation: For CRISPR knockout or siRNA experiments, validate the efficiency of ZMYM6NB depletion using both RT-qPCR and Western blot.

  • Rescue experiments: Reintroduce wild-type ZMYM6NB in knockout cells to confirm that observed phenotypes are specifically due to ZMYM6NB loss.

This follows the one-factor design principle where the experimental variable is systematically manipulated while controlling for other factors .

How can I determine the appropriate sample size for ZMYM6NB functional studies?

Determining appropriate sample size for ZMYM6NB functional studies requires careful statistical consideration beyond simply what time and budget allow . For robust experimental design:

  • Conduct a power analysis: Based on preliminary data or similar studies with related proteins like ZMYM3, estimate the expected effect size and variability.

  • Consider experimental design type: Within-subjects designs typically require fewer participants/samples than between-subjects designs to achieve the same statistical power .

  • Account for repeated measures: If using a repeated-measures design, factor in the correlation between measurements when calculating sample size .

  • Plan for multiple conditions: When investigating ZMYM6NB under various conditions (e.g., different DNA damage agents or timepoints), ensure sufficient sample size for each experimental condition or design cell .

  • Include biological replicates: For cell culture experiments, perform at least three independent biological replicates to account for variability.

What are the best methods to study ZMYM6NB localization and its potential chromatin interaction?

To characterize ZMYM6NB localization and potential chromatin interactions, consider these methodological approaches:

  • Immunofluorescence microscopy: Using antibodies against endogenous ZMYM6NB or tagged versions to visualize cellular localization under normal and stress conditions.

  • Chromatin fractionation: Separate cellular components into cytoplasmic, nuclear soluble, and chromatin-bound fractions to determine if ZMYM6NB associates with chromatin, as observed with ZMYM3 .

  • Chromatin immunoprecipitation (ChIP): Identify potential DNA binding sites of ZMYM6NB.

  • Proximity ligation assay (PLA): Detect protein-protein interactions between ZMYM6NB and chromatin components in situ.

  • FRAP (Fluorescence Recovery After Photobleaching): Assess the dynamics of ZMYM6NB binding to chromatin.

For chromatin fractionation experiments, use the following protocol table:

FractionBuffer CompositionCentrifugationExpected ZMYM6NB Presence
Cytoplasmic10 mM HEPES, 10 mM KCl, 1.5 mM MgCl₂, 0.34 M sucrose, 10% glycerol, 1 mM DTT, protease inhibitors1,300g, 5 min, 4°CLow (if nuclear)
Nuclear solubleNuclei from above, treated with hypotonic buffer1,700g, 5 min, 4°CModerate (if not chromatin-bound)
ChromatinPellet from above, treated with 0.2 N HCl16,000g, 10 min, 4°CHigh (if similar to ZMYM3)

Based on findings with ZMYM3, you might expect ZMYM6NB to be predominantly in the chromatin fraction if it shares functional similarities .

How can I identify potential binding partners of ZMYM6NB?

To identify potential binding partners of ZMYM6NB, implement these complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged ZMYM6NB (His6-tagged as in commercial preparations)

    • Perform pull-down experiments under various conditions (normal, DNA damage)

    • Analyze co-purifying proteins by mass spectrometry

    • Validate interactions by reciprocal co-immunoprecipitation

  • Proximity-dependent biotin identification (BioID):

    • Fuse ZMYM6NB to a biotin ligase (BirA*)

    • Express in cells and allow biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Yeast two-hybrid screening:

    • Use ZMYM6NB as bait to screen human cDNA libraries

    • Validate positive interactions in mammalian cells

  • Co-immunoprecipitation of predicted partners:

    • Based on knowledge from related proteins like ZMYM3, test specific interactions with predicted partners (histones, chromatin remodelers)

    • Examine these interactions under normal conditions and after DNA damage induction

For AP-MS experiments, use stringent controls including tag-only samples and analyze data using statistical methods to distinguish true interactors from background contaminants.

What experimental approaches can be used to assess ZMYM6NB's potential role in DNA repair pathways?

To investigate ZMYM6NB's potential involvement in DNA repair pathways, consider these methodological approaches:

  • DNA repair assays: Utilize reporter assays that measure specific repair pathways:

    • HR (homologous recombination) reporter assays

    • NHEJ (non-homologous end joining) reporter assays

    • SSA (single-strand annealing) reporter assays

    Compare repair efficiency in ZMYM6NB-depleted cells versus controls, similar to approaches used for ZMYM3 .

  • DNA damage sensitivity assays: Expose ZMYM6NB-depleted cells to various DNA-damaging agents (ionizing radiation, camptothecin, etoposide) and assess:

    • Cell survival (clonogenic assays)

    • DNA damage markers persistence (γH2AX foci clearance)

    • Cell cycle checkpoint activation (phosphorylation of Chk1/Chk2)

  • Live-cell imaging: Monitor recruitment kinetics of fluorescently tagged ZMYM6NB to laser-induced DNA damage sites, similar to approaches used for ZMYM3 .

  • Chromosome stability analysis: Examine metaphase spreads from ZMYM6NB-depleted cells for chromosomal aberrations following DNA damage, as was demonstrated with ZMYM3-deficient cells .

Use a within-subjects repeated-measures design where possible to enhance statistical power and distinguish signal from noise in your observations .

How can I investigate whether ZMYM6NB has deubiquitinating activity similar to other zinc finger proteins?

To determine if ZMYM6NB possesses deubiquitinating activity similar to other zinc finger proteins like ZRANB1/Trabid , implement these methodological approaches:

  • In vitro deubiquitination assays:

    • Purify recombinant ZMYM6NB protein

    • Incubate with different ubiquitin chain types (K48, K63, K29, K33)

    • Analyze reaction products by Western blot to detect ubiquitin chain cleavage

    • Include positive control (ZRANB1/Trabid) and negative control (catalytically inactive mutant)

  • Cellular ubiquitination analysis:

    • Overexpress or deplete ZMYM6NB in cells

    • Examine global ubiquitination patterns by Western blot

    • Identify specific substrates through ubiquitin remnant profiling mass spectrometry

  • Structure-function analysis:

    • Identify potential catalytic domains through sequence comparison with known deubiquitinases

    • Generate point mutations in predicted catalytic residues

    • Test mutants in deubiquitination assays

  • Chain-specific preference determination:

    • Test activity against different ubiquitin chain types (K48, K63, K11, K29, K33)

    • ZRANB1/Trabid preferentially cleaves K29-, K33-, and K63-linked poly-Ubiquitin chains , so examine whether ZMYM6NB shows similar preferences

Use appropriate experimental controls and consider the protein's stability and buffer conditions during assays.

What are common issues when working with recombinant ZMYM6NB protein and how can they be addressed?

When working with recombinant ZMYM6NB protein, researchers may encounter several challenges:

  • Protein solubility issues:

    • Problem: ZMYM6NB may form aggregates or precipitate in solution

    • Solution: Optimize buffer conditions (pH, salt concentration, reducing agents). The commercial preparation uses 50 mM HEPES pH 8.0, 100 mM NaCl, 1 mM TCEP for ZRANB1 , which may serve as a starting point for ZMYM6NB.

    • Solution: Add stabilizing agents like glycerol (10-20%)

  • Low protein activity:

    • Problem: Recombinant protein shows reduced or no enzymatic activity

    • Solution: Ensure proper protein folding by using slower expression conditions (lower temperature)

    • Solution: Check if the tag interferes with activity by testing both tagged and tag-cleaved versions

  • Protein degradation:

    • Problem: ZMYM6NB degrades during storage or experiments

    • Solution: Store at -80°C with stabilizing agents and minimize freeze-thaw cycles

    • Solution: Add protease inhibitors to all buffers used with the protein

  • Non-specific binding in pull-down assays:

    • Problem: High background in interaction studies

    • Solution: Increase stringency of wash buffers

    • Solution: Pre-clear lysates before immunoprecipitation

    • Solution: Use appropriate negative controls for each experiment

  • Inconsistent results between experiments:

    • Problem: Variable outcomes between replicates

    • Solution: Standardize protein concentration and experimental conditions

    • Solution: Use freshly prepared protein when possible or aliquot storage samples to avoid repeated freeze-thaw cycles

How should I interpret contradictory findings between ZMYM6NB and other ZMYM family members?

When faced with contradictory findings between ZMYM6NB and other ZMYM family members like ZMYM3, consider these methodological approaches for interpretation:

  • Structural differences analysis:

    • Compare domain organizations between ZMYM proteins

    • Identify unique domains or motifs in ZMYM6NB that might explain functional differences

    • Consider that ZMYM3 contains 10 ZNF domains and a DUF3504 domain , while ZMYM6NB may have a different domain structure

  • Expression pattern comparison:

    • Analyze tissue-specific or cell cycle-specific expression differences

    • Different expression patterns may explain functional specialization

  • Interaction partner divergence:

    • Compare interactomes of different ZMYM proteins

    • Unique binding partners may direct different functions

  • Evolutionary analysis:

    • Conduct phylogenetic analysis of ZMYM family members

    • Determine if ZMYM6NB is evolutionarily divergent from other family members

  • Redundancy testing:

    • Perform double knockdown/knockout experiments to test for functional redundancy

    • If ZMYM6NB and another ZMYM protein have redundant functions, single knockout phenotypes may be mild

  • Context-dependent function:

    • Test ZMYM6NB function under various cellular conditions (cell types, stress conditions)

    • Function may be context-dependent, explaining apparent contradictions

Use these approaches to develop a nuanced understanding of ZMYM6NB's unique roles compared to other family members.

How can CRISPR-Cas9 technology be optimized for studying ZMYM6NB function?

To optimize CRISPR-Cas9 approaches for studying ZMYM6NB function:

  • Guide RNA design strategy:

    • Design multiple gRNAs targeting different exons of ZMYM6NB

    • Prioritize early exons to ensure complete functional knockout

    • Screen gRNAs computationally for off-target effects

    • Test gRNA efficiency using T7 endonuclease assay or targeted sequencing

  • Knockout validation protocol:

    • Confirm genomic editing by sequencing

    • Verify protein loss by Western blot

    • Assess mRNA levels by RT-qPCR

    • Check for potential compensatory upregulation of other ZMYM family members

  • Advanced CRISPR applications:

    • Generate domain-specific deletions rather than complete knockout

    • Create specific point mutations to test functional hypotheses

    • Use base editors for precise nucleotide changes

    • Implement CRISPR interference (CRISPRi) for temporary repression

  • Inducible CRISPR systems:

    • Utilize doxycycline-inducible Cas9 for temporal control

    • Implement tissue-specific Cas9 expression for in vivo studies

    • Use degron-tagged Cas9 for rapid induction and reversal

  • Functional rescue controls:

    • Re-express CRISPR-resistant ZMYM6NB variants to confirm phenotype specificity

    • Test structure-function relationships with domain deletion mutants

    • Introduce point mutations to identify critical residues

This approach follows the experimental design principles of controlling variables and establishing clear causality through appropriate controls .

What proteomics approaches would be most effective for characterizing post-translational modifications of ZMYM6NB?

For comprehensive characterization of ZMYM6NB post-translational modifications (PTMs), implement these advanced proteomics approaches:

  • Sample preparation optimization:

    • Enrich for ZMYM6NB using immunoprecipitation or tandem affinity purification

    • Create stable cell lines expressing tagged ZMYM6NB at near-endogenous levels

    • Compare modifications under different cellular conditions (normal, stressed, cell cycle phases)

  • Mass spectrometry techniques:

    • Utilize complementary fragmentation methods (HCD, ETD, EThcD) to improve PTM identification

    • Implement parallel reaction monitoring (PRM) for targeted analysis of suspected modification sites

    • Apply data-independent acquisition (DIA) for comprehensive PTM profiling

  • PTM enrichment strategies:

    • Phosphorylation: TiO₂ or IMAC enrichment

    • Ubiquitination: Ubiquitin remnant peptide (K-ε-GG) antibody enrichment

    • Acetylation: Anti-acetyl lysine antibody enrichment

    • SUMOylation: His-tagged SUMO purification

  • Quantitative analysis:

    • Use SILAC, TMT, or iTRAQ labeling for quantitative comparison across conditions

    • Implement label-free quantification for temporal dynamics studies

    • Calculate stoichiometry of modifications at specific sites

  • Bioinformatic analysis pipeline:

    • Apply PTM site localization algorithms to determine modification positions with confidence scores

    • Use motif analysis to identify potential regulatory enzymes

    • Perform structural modeling to assess the impact of modifications on protein function

This multi-faceted approach provides comprehensive characterization of ZMYM6NB PTMs, facilitating functional hypotheses about its regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.