Recombinant Human UPF0258 protein KIAA1024-like (KIAA1024L)

Shipped with Ice Packs
In Stock

Description

Expression Systems Comparison

SystemYieldPost-Translational ModificationsTurnaround Time
E. coliHighLimitedShortest
YeastHighModerateModerate
InsectMediumExtensiveLongest
MammalianLowNative-likeLongest

Sources: E. coli and yeast are preferred for high-throughput applications, while insect/mammalian systems preserve biological activity through glycosylation and folding .

Key Research Findings

  • Cholesterol Regulation:
    KIAA1024L/Minar2 recruits cholesterol to lysosomes and hair bundle membranes. Mutations reduce cholesterol localization, leading to defective mechanotransduction in zebrafish and mice .

  • Auditory Role:

    • Homozygous Kiaa1024L knockout mice exhibit severe hearing loss (↑ auditory brainstem response thresholds) .

    • Zebrafish mutants show elongated hair bundles, enlarged lysosomes, and reduced hair cell survival .

Phenotype in MutantsRescue Method
Defective hair bundlesCholesterol supplementation
Apical lysosome aggregationPharmacological cholesterol elevation
Hearing lossGenetic complementation

Research Applications

  • Mechanotransduction Studies: Used to investigate cholesterol-dependent hair bundle function .

  • Lysosomal Biology: Tools for analyzing cholesterol trafficking (e.g., GFP/FLAG-tagged variants) .

  • Antibody Validation: Anti-KIAA1024L antibodies (e.g., Sigma HPA013760) enable immunohistochemistry at 1:20–1:50 dilutions .

Clinical Implications

Mutations in KIAA1024L correlate with congenital hearing loss, making this protein a biomarker candidate. Pharmacological modulation of cholesterol rescues auditory defects in preclinical models, suggesting therapeutic avenues .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them when placing your order. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All protein shipments are made with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
MINAR2; KIAA1024L; Major intrinsically disordered NOTCH2-binding receptor 1-like; Membrane integral NOTCH2-associated receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
KIAA1024L
Target Protein Sequence
MSSVMKNNPLYGDLSLEEAMEERKKNPSWTIEEYDKHSLHTNLSGHLKENPNDLRFWLGD MYTPGFDTLLKKEEKQEKHSKFCRMGLILLVVISILVTIVTIITFFT
Uniprot No.

Target Background

Database Links

HGNC: 33914

KEGG: hsa:100127206

STRING: 9606.ENSP00000454268

UniGene: Hs.582534

Protein Families
UPF0258 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is KIAA1024L/Minar2 and to which protein family does it belong?

KIAA1024L/Minar2 is a member of the UPF0258 protein family, a previously understudied group of proteins. The UPF0258 family includes KIAA1024/Minar1/Ubtor and KIAA1024L/Minar2. In zebrafish, the family consists of two Minar1 orthologs (ubtora/minar1a and ubtorb/minar1b) and a single Minar2 gene. Functional studies have revealed that KIAA1024L/Minar2 plays an essential role in hearing processes through the regulation of cholesterol distribution and homeostasis, particularly in sensory hair cells .

What are the known expression patterns of KIAA1024L/Minar2 across different tissues?

KIAA1024L/Minar2 expression has been most thoroughly characterized in auditory tissues. In zebrafish, kiaa1024L/minar2 is prominently expressed in mechanosensory hair cells, which are critical for hearing function. The protein localizes to stereocilia and apical endo-membranes of these specialized cells. Beyond auditory tissues, expression analysis suggests potential roles in other cell types, but auditory hair cells appear to be a primary site of functional importance. To determine tissue-specific expression patterns, researchers typically employ techniques such as in situ hybridization, immunohistochemistry, and qPCR analysis in both wild-type and mutant contexts .

How was KIAA1024L/Minar2 initially identified as a hearing-related gene?

KIAA1024L/Minar2 was first identified as hearing-related through a systematic hearing loss screen in mouse knockout strains using auditory brainstem response (ABR) testing. Researchers observed that homozygous Kiaa1024L/Minar2 knockout mice aged 14 weeks exhibited severely elevated ABR thresholds across all frequencies tested, indicating significant hearing impairment. This initial finding led to further investigations in zebrafish models, where disruption of kiaa1024L/minar2 similarly caused hearing deficits, confirming its evolutionary conserved role in auditory function .

What is the subcellular localization of KIAA1024L/Minar2 protein and how does it relate to its function?

Subcellular localization studies have revealed that KIAA1024L/Minar2 primarily resides in lysosomes. In hair cells specifically, GFP-tagged Kiaa1024L/Minar2 was observed distributed in both stereocilia and apical endo-membranes. This dual localization pattern is significant as it positions the protein at critical sites for cholesterol regulation. The lysosomal localization was confirmed in cultured cells, where overexpression of KIAA1024L/Minar2 resulted in recruitment of cholesterol to these organelles and increased intracellular cholesterol levels. The protein's presence in stereocilia membrane correlates with its function in maintaining appropriate cholesterol levels in hair bundles, which is essential for proper mechanotransduction in hearing .

What mechanisms underlie KIAA1024L/Minar2's regulation of cholesterol homeostasis?

The mechanisms through which KIAA1024L/Minar2 regulates cholesterol homeostasis involve:

  • Lysosomal cholesterol trafficking: KIAA1024L/Minar2 appears to facilitate cholesterol movement from lysosomes to other cellular compartments, particularly the plasma membrane of stereocilia in hair cells.

  • Cholesterol enrichment in specific membrane domains: Research shows that an accessible pool of cholesterol is highly enriched in hair bundle membranes, and KIAA1024L/Minar2 is essential for maintaining this distribution.

  • Impact on membrane properties: By regulating cholesterol levels, KIAA1024L/Minar2 likely influences membrane fluidity and organization, which is critical for the function of mechanosensitive ion channels involved in hearing.

Experimental evidence supporting these mechanisms comes from the observation that loss of kiaa1024L/minar2 reduces cholesterol distribution in hair bundles, while pharmacological manipulation of cholesterol levels affects hair cell function in predictable ways—decreasing cholesterol exacerbates defects, while increasing cholesterol rescues function in mutants .

How does KIAA1024L/Minar2 compare structurally and functionally to other UPF0258 family members?

The UPF0258 family includes KIAA1024/Minar1/Ubtor and KIAA1024L/Minar2, which share structural similarities but may have divergent functions. While detailed structural comparisons are still emerging, functional differences have been observed:

FeatureKIAA1024L/Minar2KIAA1024/Minar1/Ubtor
Primary functionCholesterol regulation in hearingInvolved in various processes including potential roles in cancer and viral infection
Expression patternEnriched in mechanosensory hair cellsBroader expression across multiple tissues
Subcellular localizationPredominantly lysosomal and stereocilia membraneMembrane-associated with wider distribution
Loss-of-function phenotypeHearing deficit in mouse and zebrafishVariable depending on tissue context

Unlike the well-characterized UPF proteins involved in nonsense-mediated decay (NMD) and oxidative stress responses in other organisms like N. crassa, the UPF0258 family (including KIAA1024L/Minar2) appears to have distinct functions related to cholesterol metabolism and membrane organization .

What are the most effective approaches for studying KIAA1024L/Minar2 function in vitro?

For in vitro studies of KIAA1024L/Minar2, researchers have successfully employed several methodological approaches:

  • Cell culture systems: HEK293 and Cos-7 cells have been effectively used to study KIAA1024L/Minar2 localization and function. When transfected with GFP-tagged KIAA1024L/Minar2, these cells show characteristic lysosomal localization of the protein.

  • Subcellular localization analysis: Co-localization studies with organelle markers (particularly lysotracker for lysosomes) provide valuable information about KIAA1024L/Minar2's cellular distribution.

  • Cholesterol labeling and quantification: Techniques such as filipin staining or fluorescent cholesterol analogs can be used to visualize and quantify cellular cholesterol content and distribution in the presence and absence of KIAA1024L/Minar2.

  • Overexpression and knockdown approaches: Transfection with expression constructs or siRNA/shRNA targeting KIAA1024L/Minar2 allows for gain- and loss-of-function studies to assess its impact on cholesterol metabolism.

  • Cholesterol modulators: Pharmacological agents that increase or decrease cellular cholesterol can be applied to determine how KIAA1024L/Minar2 interacts with cholesterol homeostasis pathways.

These approaches should be complemented with appropriate controls, including empty vector transfections and DMSO-treated controls for drug studies .

What model systems are most appropriate for investigating KIAA1024L/Minar2 in vivo?

Several model systems have proven valuable for in vivo studies of KIAA1024L/Minar2:

Model SystemAdvantagesKey ApplicationsNotable Findings
ZebrafishTransparent larvae allow for live imaging; rapid development; accessible hair cellsAnalysis of mechanotransduction; hearing assessments; drug treatmentsDisruption causes hearing loss; cholesterol modulation affects phenotype
MouseMammalian auditory system; sophisticated hearing tests possibleLong-term hearing studies; detailed inner ear analysisKnockout mice show severe hearing loss
Cell CultureControlled environment; amenable to biochemical analysisProtein localization; cholesterol trafficking studiesKIAA1024L/Minar2 localizes to lysosomes and recruits cholesterol

The zebrafish model has been particularly informative, as mutant larvae exhibit defects in mechanotransduction, longer and thinner hair bundles, and enlarged apical lysosomes in hair cells. Additionally, functional assays such as acoustic startle response tests and microphonic potentials provide quantitative measures of hearing function. For cellular studies, both hair cell-derived lines and heterologous expression systems like HEK293 cells have been successfully employed .

What techniques are recommended for assessing cholesterol distribution in hair cells when studying KIAA1024L/Minar2?

For accurate assessment of cholesterol distribution in hair cells when studying KIAA1024L/Minar2, the following specialized techniques are recommended:

  • Filipin staining: This polyene antibiotic binds specifically to unesterified cholesterol and can be visualized by fluorescence microscopy. In hair cells, filipin staining reveals an accessible pool of cholesterol highly enriched in hair bundle membranes that is reduced in kiaa1024L/minar2 mutants.

  • Domain-specific cholesterol labeling: By using membrane-impermeant cholesterol probes, researchers can distinguish between cholesterol in the outer leaflet of the plasma membrane versus intracellular pools.

  • Super-resolution microscopy: Techniques such as STORM or STED microscopy provide nanoscale resolution of cholesterol distribution in hair bundle membranes, offering insights into how KIAA1024L/Minar2 affects cholesterol organization.

  • Pharmacological manipulation combined with functional assays: Application of cholesterol-modulating drugs (such as methyl-β-cyclodextrin to extract cholesterol or water-soluble cholesterol to supplement it) followed by assessment of mechanotransduction currents or acoustic startle responses provides functional correlates to cholesterol distribution.

  • Cholesterol biosensors: Genetically encoded cholesterol sensors expressed in hair cells can provide real-time information about cholesterol dynamics in living cells.

These approaches should be combined with appropriate controls and quantification methods to ensure reliable assessment of cholesterol distribution in the specialized compartments of hair cells .

What human hearing disorders are associated with KIAA1024L/Minar2 mutations?

Based on animal model studies, KIAA1024L/Minar2 mutations are strongly implicated in sensorineural hearing loss. In mice, homozygous Kiaa1024L/Minar2 knockout results in severely elevated auditory brainstem response (ABR) thresholds across all frequencies tested. Although direct human genetic studies linking KIAA1024L/Minar2 mutations to specific hearing disorders are still emerging, the strong conservation of inner ear development and function across vertebrates suggests that mutations in this gene likely contribute to hereditary hearing impairment in humans. Research examining KIAA1024L/Minar2 variants in cohorts of patients with unexplained hearing loss would be valuable for establishing direct clinical associations. Based on the underlying mechanism of cholesterol dysregulation, KIAA1024L/Minar2-related hearing loss would likely manifest as progressive sensorineural hearing loss affecting multiple frequencies .

How might cholesterol-modulating therapies potentially address KIAA1024L/Minar2-related hearing deficits?

The discovery that KIAA1024L/Minar2 regulates cholesterol distribution in hair cells opens potential therapeutic avenues for addressing associated hearing deficits. Experimental evidence from zebrafish models demonstrates that increasing cholesterol levels can rescue hair cell defects and hearing function in kiaa1024L/minar2 mutants. This suggests that cholesterol supplementation or modulation of cholesterol transport might be viable therapeutic strategies.

Potential therapeutic approaches could include:

  • Local delivery of cholesterol to the inner ear through specialized formulations

  • Small molecule enhancers of alternative cholesterol transport pathways to bypass KIAA1024L/Minar2 deficiency

  • Gene therapy approaches to restore functional KIAA1024L/Minar2 expression

  • Targeting downstream effectors in the cholesterol-dependent mechanotransduction pathway

  • Developing delivery methods that can effectively target inner ear hair cells

  • Determining the optimal cholesterol concentration and formulation

  • Establishing the therapeutic window during which intervention would be most effective

  • Assessing potential side effects of manipulating cholesterol levels in the inner ear

Importantly, drug treatments that decrease cholesterol levels could potentially exacerbate hearing deficits in individuals with KIAA1024L/Minar2 mutations, suggesting that monitoring of hearing should be considered in patients with genetic variants in this gene who are prescribed cholesterol-lowering medications .

What are the molecular mechanisms by which KIAA1024L/Minar2 influences cholesterol trafficking and membrane organization?

The precise molecular mechanisms through which KIAA1024L/Minar2 regulates cholesterol trafficking remain incompletely understood and represent a frontier for advanced research. Several hypotheses warrant investigation:

  • Direct cholesterol binding: KIAA1024L/Minar2 may contain cholesterol-binding domains that directly facilitate cholesterol transport from lysosomes to plasma membrane or other cellular compartments.

  • Interaction with established cholesterol transport machinery: KIAA1024L/Minar2 could modulate the activity of known cholesterol transporters such as NPC1/NPC2 or ABC transporters.

  • Regulation of membrane contact sites: The protein might facilitate the formation or function of membrane contact sites between lysosomes and the plasma membrane, which serve as conduits for lipid transfer.

  • Impact on lipid raft organization: Beyond bulk cholesterol levels, KIAA1024L/Minar2 may influence the nanoscale organization of cholesterol-enriched membrane domains critical for mechanotransduction.

Methodological approaches to address these questions include protein-lipid binding assays, proximity labeling techniques to identify interaction partners, electron microscopy to visualize membrane contact sites, and advanced lipidomics to characterize membrane composition changes in KIAA1024L/Minar2 mutants .

How do compensatory mechanisms mitigate KIAA1024L/Minar2 deficiency across different species and tissues?

An intriguing observation is that zebrafish with kiaa1024L/minar2 mutations display less severe phenotypes than mouse knockouts, suggesting potential compensatory mechanisms. This phenomenon raises several advanced research questions:

  • Genetic compensation: While expression levels of minar1a and minar1b were not significantly altered in zebrafish minar2 mutants, other genes outside the UPF0258 family might compensate for minar2 loss. Transcriptomic and proteomic profiling of mutant tissues could identify upregulated compensatory pathways.

  • Species-specific differences in cholesterol metabolism: Different vertebrates may have evolved distinct mechanisms for maintaining cholesterol homeostasis in specialized cells like hair cells, potentially explaining differential sensitivity to KIAA1024L/Minar2 loss.

  • Temporal aspects of compensation: Compensatory mechanisms might be more effective during certain developmental windows or may emerge gradually over time, explaining age-dependent phenotypes.

  • Tissue-specific redundancy: The degree of functional overlap between KIAA1024L/Minar2 and related proteins may vary across different tissues, leading to tissue-specific phenotypic manifestations.

Comparative studies across multiple model organisms, combined with temporal analysis of gene expression and cholesterol distribution, would provide insights into these compensatory mechanisms. Such understanding could potentially be leveraged to enhance natural compensatory responses as a therapeutic strategy .

What is the relationship between KIAA1024L/Minar2 and other UPF family proteins in different cellular contexts?

The UPF protein family includes both the UPF0258 members (like KIAA1024L/Minar2) and the canonical UPF proteins (UPF1, UPF2, UPF3) involved in nonsense-mediated decay (NMD) and other cellular processes. The functional relationship between these different UPF proteins remains an open question worthy of advanced investigation:

  • Evolutionary relationships: While sharing the UPF designation, these protein families may have distinct evolutionary origins and specialized functions that have converged on similar naming conventions.

  • Potential functional interactions: Whether KIAA1024L/Minar2 interacts with canonical UPF proteins in specific cellular contexts remains unexplored. For example, in N. crassa, UPF proteins respond to oxidative stress by regulating gene expression through protein degradation. Whether similar stress-responsive mechanisms exist for KIAA1024L/Minar2 is unknown.

  • Structural similarities and differences: Detailed structural analysis might reveal shared domains or motifs that could suggest functional relationships, despite apparent divergence in primary functions.

  • Tissue-specific roles: The canonical UPF complex, best known for its role in NMD, could potentially interact with KIAA1024L/Minar2 in specific tissues like auditory hair cells.

Methodological approaches to investigate these relationships include co-immunoprecipitation studies, proximity labeling techniques, and comparative structure-function analyses across different UPF family members .

What control experiments are essential when investigating KIAA1024L/Minar2 function in hearing loss models?

When designing experiments to investigate KIAA1024L/Minar2 function in hearing loss models, several critical controls must be included to ensure data integrity and interpretability:

  • Genetic controls:

    • Wild-type vs. heterozygous vs. homozygous mutant comparisons

    • Rescue experiments through transgenic re-expression of KIAA1024L/Minar2 to confirm phenotype specificity

    • Multiple independent mutant alleles to confirm consistency of phenotypes

    • Assessment of potential genetic compensatory responses (e.g., expression changes in minar1a/b)

  • Phenotypic controls:

    • Comprehensive hearing assessments across multiple frequencies and ages

    • Evaluation of hair cell morphology alongside functional tests

    • Distinction between developmental versus maintenance defects through temporally controlled manipulations

  • Cholesterol manipulation controls:

    • Vehicle-only treatments alongside cholesterol-modulating drugs

    • Dose-response relationships for cholesterol supplementation and depletion

    • Time-course experiments to determine optimal intervention windows

    • Verification of cholesterol level changes using appropriate staining or biochemical assays

  • Cellular and subcellular controls:

    • Multiple cell types to determine specificity of KIAA1024L/Minar2 function

    • Proper organelle markers to confirm subcellular localization

    • Tagged and untagged protein versions to ensure tag does not interfere with function

    • Both gain- and loss-of-function approaches to comprehensively assess function

These controls help address potential confounding factors and ensure that observed phenotypes are specifically attributable to KIAA1024L/Minar2 function .

How should researchers address contradictory findings between mouse and zebrafish KIAA1024L/Minar2 models?

When confronted with contradictory findings between mouse and zebrafish KIAA1024L/Minar2 models, researchers should implement a systematic approach to reconcile these differences:

  • Direct comparison studies:

    • Analyze both models using identical methodologies where possible

    • Assess phenotypes at equivalent developmental stages

    • Employ the same functional assays calibrated appropriately for each species

  • Molecular mechanism investigation:

    • Compare protein sequence homology and domain conservation

    • Assess expression patterns and levels across species

    • Evaluate potential species-specific protein interactions

  • Genetic background considerations:

    • Test multiple genetic backgrounds within each species

    • Consider the impact of strain-specific modifier genes

    • Create knock-in models with the orthologous gene from the other species

  • Compensatory mechanism assessment:

    • Perform transcriptomic analyses to identify differentially regulated genes

    • Investigate temporal dynamics of compensation

    • Create double/triple mutants of related genes to uncover redundant pathways

  • Methodological differences:

    • Account for technical differences in phenotype assessment

    • Consider environmental factors specific to each model system

    • Standardize analysis methods across species

A particularly valuable approach is creating cross-species complementation experiments, where the zebrafish kiaa1024L/minar2 gene is expressed in mouse knockout models and vice versa, to determine functional conservation directly. Additionally, expanding studies to include other model organisms might provide broader evolutionary context for reconciling species differences .

What statistical approaches are most appropriate for analyzing KIAA1024L/Minar2 phenotypes in different model systems?

When analyzing KIAA1024L/Minar2 phenotypes across different model systems, researchers should employ appropriate statistical approaches tailored to the specific data types and experimental designs:

Data TypeRecommended Statistical MethodsConsiderations
Hearing thresholdsANOVA with post-hoc tests for multiple comparisonsAccount for frequency-specific effects; consider repeated measures designs for longitudinal data
Hair cell morphologyMixed-effects models for nested data (multiple cells within animals)Include random effects for individual animals; use appropriate transformations for non-normal data
Cholesterol distributionSpatial statistics; intensity correlation analysesConsider regionalized measurements rather than whole-cell averages
Gene expressionDifferential expression analysis with multiple testing correctionValidate key findings with independent methods (e.g., qPCR)
Behavioral assaysNon-parametric tests for non-normal distributionsConsider potential batch effects and circadian influences

For all analyses, researchers should:

  • Determine appropriate sample sizes through power analysis

  • Test data for normality and homogeneity of variance

  • Consider both biological and technical replicates in experimental design

  • Use blinded analysis whenever possible to prevent bias

  • Report effect sizes alongside p-values to indicate biological significance

How can researchers effectively integrate multi-omics data to understand KIAA1024L/Minar2 function in cholesterol regulation?

Integrating multi-omics data provides a powerful approach to comprehensively understand KIAA1024L/Minar2 function in cholesterol regulation. Researchers should consider the following methodological framework:

  • Data collection strategy:

    • Transcriptomics: RNA-seq of wild-type vs. mutant tissues, focusing on hair cells when possible

    • Proteomics: Quantitative proteomic analysis with attention to membrane and lysosomal fractions

    • Lipidomics: Comprehensive profiling of cholesterol and other lipids in relevant cellular compartments

    • Interactomics: Proximity labeling or co-immunoprecipitation to identify protein interaction networks

    • Epigenomics: Analysis of potential regulatory mechanisms affecting compensatory responses

  • Integration approaches:

    • Pathway enrichment analysis across multiple data types

    • Network-based integration to identify functional modules

    • Time-course analyses to capture dynamic responses

    • Causal modeling to infer regulatory relationships

  • Validation strategies:

    • Targeted experiments to confirm key predictions from integrated analyses

    • Perturbation studies of identified pathways

    • Cross-species validation of core mechanisms

  • Computational considerations:

    • Dimensionality reduction techniques for high-dimensional data

    • Machine learning approaches to identify patterns across data types

    • Careful batch correction and normalization between datasets

This integrated approach can reveal not only direct effects of KIAA1024L/Minar2 on cholesterol regulation but also broader impacts on cellular physiology and potential compensatory mechanisms. A particularly valuable strategy would be to compare multi-omics profiles between zebrafish and mouse models to identify conserved and divergent responses to KIAA1024L/Minar2 deficiency .

What screening strategies could identify potential therapeutic compounds for KIAA1024L/Minar2-related hearing loss?

Developing effective screening strategies for therapeutic compounds targeting KIAA1024L/Minar2-related hearing loss requires a multi-tiered approach that leverages the mechanistic understanding of cholesterol regulation by this protein:

  • Primary screening platforms:

    • Cell-based assays using fluorescent cholesterol sensors in KIAA1024L/Minar2-deficient cells

    • Zebrafish-based screening using transgenic reporters of hair cell function

    • High-content imaging of cholesterol distribution in hair cells

    • In vitro assays of membrane fluidity and organization

  • Compound libraries to consider:

    • FDA-approved drugs for potential repurposing

    • Cholesterol transport modulators

    • Lysosomal function enhancers

    • Small molecules targeting related cholesterol regulatory pathways

  • Secondary validation assays:

    • Electrophysiological assessment of mechanotransduction in hair cells

    • Acoustic startle response in zebrafish models

    • Detailed analysis of hair bundle morphology and cholesterol distribution

    • Assessment of potential toxicity and off-target effects

  • Criteria for hit selection:

    • Efficacy in restoring cholesterol distribution to hair bundles

    • Improvement in functional hearing measures

    • Acceptable safety profile

    • BBB permeability and/or amenability to local delivery to the inner ear

    • Evidence of target engagement

A particularly promising approach would be to develop organ-on-chip models of the inner ear that incorporate KIAA1024L/Minar2-deficient hair cells, enabling more physiologically relevant screening while reducing animal usage. Additionally, patient-derived induced pluripotent stem cells differentiated into hair cell-like cells could provide a human-relevant screening platform .

How might advances in understanding KIAA1024L/Minar2 inform broader research on cholesterol-related disorders?

The insights gained from KIAA1024L/Minar2 research have potential to inform our understanding of cholesterol-related disorders more broadly, creating translational research opportunities:

  • Mechanistic insights:

    • KIAA1024L/Minar2's role in redistributing cholesterol from lysosomes to specific membrane domains may illuminate similar processes in other tissues

    • Understanding how cells maintain cholesterol homeostasis in specialized membrane regions could inform research on neurological disorders where membrane composition is critical

    • The link between cholesterol distribution and mechanosensation may have relevance for other mechanosensitive processes throughout the body

  • Methodological advances:

    • Techniques developed to visualize and quantify cholesterol in hair cell stereocilia can be adapted to study cholesterol in other specialized cellular structures

    • Animal models and genetic tools created for KIAA1024L/Minar2 research may facilitate studies of related proteins in different contexts

    • High-throughput screens designed for hearing loss may be repurposed for other cholesterol-related conditions

  • Clinical applications:

    • Cholesterol-modulating therapies developed for KIAA1024L/Minar2-related hearing loss might have applications in other disorders of cholesterol trafficking

    • Genetic testing strategies could be expanded to include KIAA1024L/Minar2 and related genes in broader screening panels

    • Biomarkers of cholesterol distribution identified in hearing research might serve as indicators in other conditions

  • Broader implications:

    • The role of KIAA1024L/Minar2 in hearing highlights how tissue-specific cholesterol regulation contributes to specialized functions

    • This research underscores the importance of studying cholesterol not just in terms of total levels but also in terms of subcellular distribution and membrane organization

By contextualizing KIAA1024L/Minar2 research within the broader landscape of cholesterol biology, researchers can identify synergistic opportunities for translational advances across multiple disease areas .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.