Recombinant Human UPF0414 transmembrane protein C20orf30 (C20orf30)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TMEM230; C20orf30; HSPC274; UNQ2432/PRO4992; Transmembrane protein 230
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM230
Target Protein Sequence
MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLI IIGSLLLSGYISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Uniprot No.

Target Background

Function
Involved in trafficking and recycling of synaptic vesicles.
Gene References Into Functions

Research Findings on TMEM230 and Neurological Disease:

  1. A study of a southern Spanish population indicated a low incidence of pathogenic TMEM230 variations, suggesting a limited role in familial and sporadic Parkinson's disease. PMID: 29771939
  2. Research on the Italian population suggests TMEM230 mutations are not a frequent cause of Parkinson's disease with autosomal dominant inheritance. PMID: 28318986
  3. TMEM230 mutations were found to be rare in Chinese patients with familial Parkinson's disease. PMID: 28038866
  4. Studies indicate that TMEM230 mutations are not a common cause of Parkinson's disease. PMID: 28090676
  5. A study found the TMEM230 stop codon mutation to be rare in Parkinson's disease and essential tremor patients from China, particularly in eastern China. PMID: 27869322
  6. Research did not identify any functional exonic TMEM230 variants in sporadic multiple system atrophy in a Han Chinese cohort. PMID: 28320143
  7. Findings suggest TMEM230 gene mutations may be infrequent in Chinese populations and may not be a primary factor in sporadic Parkinson's disease among the Chinese Han population. PMID: 28446760
  8. The identification of TMEM230 as a component of granulovacuolar degeneration and dystrophic neurites suggests its dysregulation may play a significant role in Alzheimer's disease pathogenesis. PMID: 28527219
  9. The identification of TMEM230 mutations in Parkinson's disease is a potentially significant finding. PMID: 28568905
  10. TMEM230 mutations might be a rare cause of familial and sporadic Parkinson's disease in Chinese patients. PMID: 28709721
  11. Mutations in the TMEM230 gene are not associated with Parkinson's disease. PMID: 28766910
  12. TMEM230 mutations may not be a common genetic factor for familial and sporadic Parkinson's disease in Chinese patients. PMID: 27814995
  13. No variants in the TMEM230 region were found associated with Parkinson's disease, age of onset, or cerebrospinal fluid alpha-synuclein levels. PMID: 28457580
  14. Mutations in TMEM230 have been associated with Parkinson's disease (PD). PMID: 27818000
  15. TMEM230 mutations are associated with Parkinson's disease. PMID: 27270108
  16. Knockdown of LRRK2, another Parkinson's disease gene that phosphorylates Rab8a, similarly impairs retromer trafficking, secretory autophagy, and Golgi-derived vesicle secretion. This suggests converging roles of TMEM230 and LRRK2 on Rab8a function and indicates that retromer and secretory dysfunction play a significant role in Parkinson's disease pathogenesis. PMID: 28115417
Database Links

HGNC: 15876

OMIM: 168600

KEGG: hsa:29058

STRING: 9606.ENSP00000341364

UniGene: Hs.472024

Involvement In Disease
Parkinson disease (PARK)
Protein Families
TMEM134/TMEM230 family
Subcellular Location
Membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Early endosome. Recycling endosome. Late endosome. Cytoplasmic vesicle, autophagosome.

Q&A

Basic Research Questions

  • What is the molecular structure and basic characteristics of TMEM230/C20orf30?

    TMEM230, also known as C20orf30, is a transmembrane protein primarily localized in synaptic vesicles in neurons. The protein has the following characteristics:

    ParameterValue
    Sequence Length (AA)120
    Molecular Weight (Da)13,188
    Official Gene SymbolTMEM230
    Other AliasesC20orf30
    Gene ID (NCBI)29058

    The protein sequence begins with "MMPSRTNLAT GIPSSKVKYS RLSSTDDGYI DLQFKKTPPK IPYKAIALAT" and contains two isoforms produced by alternative splicing . TMEM230 is primarily a transmembrane protein found in synaptic vesicles, and disease-linked mutations in this protein have been associated with Parkinson's disease through impaired synaptic vesicle trafficking .

  • What standard experimental methods are commonly used to detect and analyze TMEM230?

    Several experimental methods are used for TMEM230 detection and analysis:

    ApplicationMethodologyDilution/Parameters
    Western Blot (WB)Antibody detection1:1000-1:4000
    Immunohistochemistry (IHC)Tissue visualization1:50-1:500
    Immunofluorescence (IF)Cellular localizationAs cited in publications
    ELISAProtein quantificationVarious kits available

    For phosphorylation detection, the Fred Hutchinson Cancer Research Center has developed an assay (CPTAC-960) for detecting phosphorylation at S24, using IMAC (Immobilized Metal Affinity Chromatography) enrichment coupled with Multiple Reaction Monitoring (MRM) . This technique enables reproducible quantification of phospho-signaling.

  • How are recombinant versions of TMEM230/C20orf30 produced and stored?

    Recombinant TMEM230 protein can be produced using several expression systems:

    Expression SystemApplicationsPurity
    E. coliBasic protein studies≥85%
    YeastPost-translational modifications≥85%
    BaculovirusEukaryotic modifications≥85%
    Mammalian CellNative-like folding≥85%
    Cell-Free ExpressionRapid production≥85%

    For storage, the recommended conditions are -20°C for long-term storage, with -80°C for extended periods. Working aliquots can be stored at 4°C for up to one week. Repeated freezing and thawing is not recommended as it may affect protein stability and activity .

Advanced Research Questions

  • What experimental design considerations are important when studying TMEM230's role in neurodegeneration?

    When designing experiments to study TMEM230's role in neurodegeneration, researchers should consider:

    1. Variable control: Define clear independent variables (e.g., TMEM230 mutations, expression levels) and dependent variables (e.g., vesicle trafficking metrics, neuronal viability) .

    2. Model selection: Choose appropriate models ranging from cell lines (HEK-293, HeLa, neuronal cell lines) to animal models with consideration of species differences in TMEM230 function .

    3. Temporal dynamics: Implement time-series experimental designs to capture progressive effects of TMEM230 dysfunction, as neurodegenerative processes develop over time .

    4. Control groups: Include both positive controls (known disease-causing mutations) and negative controls (wild-type TMEM230) .

    5. Co-localization studies: Design experiments to evaluate TMEM230 interaction with syntaxin 6 (STX6) in the trans-Golgi network and other relevant trafficking proteins .

    The relationship between TMEM230 mutations and Parkinson's disease was established through rigorous experimental design including genome-wide linkage analysis with multiple microsatellite markers, which yielded two-point LOD scores over 3.3 and multi-point scores over 3.8 for markers on chromosome 20 .

  • How can researchers resolve contradictory findings in TMEM230 functional studies?

    Contradiction resolution in TMEM230 research requires systematic approaches:

    1. Sparse-Aware Analytical Methods: Recent studies have developed "SparseCL" approaches, which utilize specially trained sentence embeddings to identify contradictions in research data. This method combines cosine similarity metrics with sparsity functions to efficiently detect contradictory findings across large document corpora .

    2. Mixed Methods Approach: Combine qualitative and quantitative research methods to triangulate findings. For example, when studying TMEM230's role in vesicle trafficking, complement quantitative trafficking assays with qualitative immunofluorescence visualization .

    3. Systematic Variable Isolation: When contradictory results appear, systematically isolate variables by:

      • Testing different antibody clones and dilutions

      • Comparing expression systems (bacterial vs. mammalian)

      • Evaluating cell-type specific effects

      • Controlling for post-translational modifications

    4. Meta-analytical Framework: Apply formal meta-analytical techniques to integrate contradictory findings across studies, weighting results by methodological rigor and sample size .

  • What methodological approaches are recommended for studying TMEM230's interactions with other proteins?

    To study TMEM230's protein interactions, researchers should consider these methodological approaches:

    1. RNA-binding protein immunoprecipitation (RIP) coupled with microarray analysis: Similar to methods used for studying Musashi1 downstream targets, this approach can identify RNA interactions of TMEM230 .

    2. Co-immunoprecipitation protocol:

      • Isolate RNP complexes using appropriate buffers (e.g., NT2 buffer)

      • Perform SDS-PAGE separation

      • Conduct Western blots with specific antibodies

      • For precipitation Western blots, re-suspend beads in SDS-loading buffer and heat at 95°C for 10 minutes before analysis

    3. Subcellular co-localization studies:

      • Test markers for different organelles (mitochondria, lysosomes, endoplasmic reticulum)

      • Evaluate Golgi apparatus markers like GOLGA2 (cis-Golgi matrix protein)

      • Assess co-localization with transmembrane proteins like syntaxin 6 (STX6) in the trans-Golgi network

    4. Phosphorylation analysis: Use enrichment methods like IMAC coupled to multiple reaction monitoring for detecting phosphorylation states, as has been established in the CPTAC-960 assay for the S24 phosphorylation site .

  • What considerations should guide experimental design when testing TMEM230 variants across different species?

    When designing cross-species experiments for TMEM230 research:

    1. Sequence homology analysis: Compare TMEM230 sequences across species to identify conserved domains that might be functionally critical. Available recombinant proteins from multiple species (human, rat, mouse, chicken, bovine) facilitate comparative studies .

    2. Expression pattern comparison: Design experiments to compare tissue-specific expression patterns across species using equivalent detection methods (e.g., standardized IHC protocols) .

    3. Functional conservation testing: Implement rescue experiments where the human TMEM230 is expressed in model organisms with knocked-out endogenous TMEM230 to test functional conservation.

    4. Species-specific post-translational modifications: Design protocols to identify species-specific differences in phosphorylation, glycosylation, or other modifications that might affect function.

    5. Experimental control design: When comparing across species, ensure proper controls by:

      • Using both between-subjects and within-subjects designs where appropriate

      • Applying counterbalanced designs to control for order effects

      • Implementing equivalent time-samples design when temporal effects are important

  • How can advanced data analysis techniques be applied to TMEM230 experimental results?

    Advanced data analysis for TMEM230 research includes:

    1. Microarray data analysis workflow:

      • Quality evaluation through diagnostic plots and hierarchical clustering

      • Background correction using "normexp + offset" method

      • Within-arrays normalization using "loess" method

      • Between-arrays normalization using "Aquantile" method

      • Differential expression assessment through linear models and Bayes' methods (LIMMA model)

      • Establishing thresholds (e.g., 2-fold enrichment/reduction with adjusted FDR p-values below 0.05)

    2. Quantitative phosphoproteomics:

      • Implement IMAC-MRM (Immobilized Metal Affinity Chromatography coupled to Multiple Reaction Monitoring)

      • Establish standard curves using synthetic peptides

      • Normalize data using internal standards labeled with 13C and 15N

      • Apply appropriate statistical models for phosphorylation site occupancy

    3. Genetic linkage analysis:

      • Calculate LOD scores for genetic markers (scores >3.3 for two-point analysis and >3.8 for multi-point analysis are significant)

      • Construct genetic haplotypes to identify disease-associated variants

      • Define minimum candidate regions through analysis of crossover events

Research Application Questions

  • What are the most effective experimental approaches for evaluating TMEM230's role in Parkinson's disease?

    Effective experimental approaches include:

    1. Family-based genetic studies: Collect DNA samples from affected families and perform genome-wide linkage analysis using microsatellite markers, as demonstrated in studies that identified TMEM230 mutations in familial Parkinson's disease .

    2. Cellular trafficking assays: Design experiments to quantify vesicle trafficking efficiency in cells expressing wild-type versus mutant TMEM230, focusing on:

      • Vesicle formation rates

      • Trafficking velocities

      • Fusion events

      • Recycling efficiency

    3. Transgenic animal models: Develop animal models expressing Parkinson's disease-associated TMEM230 mutations to study:

      • Age-dependent neurodegeneration

      • Motor function deficits

      • Response to therapeutic interventions

    4. Structural biology approaches: Implement techniques to understand how disease-associated mutations alter TMEM230 structure and function.

    These approaches should be designed with appropriate controls, multiple technical and biological replicates, and blinded assessment of outcomes to ensure reliability and validity .

  • How can researchers design experiments to identify novel functions of TMEM230/C20orf30?

    To identify novel TMEM230 functions, design experiments that:

    1. Employ unbiased interaction screens:

      • Yeast two-hybrid screening

      • BioID proximity labeling

      • Mass spectrometry-based interactome analysis

      • RNA-seq following TMEM230 manipulation

    2. Utilize CRISPR-Cas9 screening:

      • Design genome-wide or pathway-focused CRISPR libraries

      • Screen for phenotypes after TMEM230 knockout in various cellular contexts

      • Validate hits with individual knockout/knockdown experiments

    3. Implement time-series experimental designs:

      • Monitor changes in cellular processes following inducible TMEM230 expression

      • Capture temporal dynamics of responses to identify primary versus secondary effects

      • Apply appropriate statistical tests for time-series data

    4. Develop tissue-specific conditional knockout models:

      • Generate animal models with conditional TMEM230 deletion

      • Systematically characterize phenotypes across tissues and developmental stages

      • Apply factorial experimental designs to test interactions with environmental factors

  • What methodological considerations are important when performing phosphorylation studies on TMEM230?

    For phosphorylation studies of TMEM230:

    1. Site identification strategy:

      • Use phospho-specific antibodies for known sites (e.g., S24)

      • Employ mass spectrometry for unbiased phosphosite mapping

      • Utilize prediction algorithms to identify potential kinase recognition motifs

    2. Enrichment techniques:

      • IMAC (Immobilized Metal Affinity Chromatography) for phosphopeptide enrichment

      • Titanium dioxide (TiO₂) chromatography as an alternative approach

      • Phospho-specific antibody immunoprecipitation for targeted analyses

    3. Quantification methods:

      • Multiple Reaction Monitoring (MRM) for targeted quantification

      • Parallel Reaction Monitoring (PRM) for improved selectivity

      • Label-free or isotope labeling strategies (SILAC, TMT, iTRAQ)

    4. Biological significance assessment:

      • Mutation of phosphosites to non-phosphorylatable residues (e.g., S→A)

      • Phosphomimetic mutations (e.g., S→D or S→E)

      • Pharmacological manipulation of relevant kinases and phosphatases

    The assay developed by the Fred Hutchinson Cancer Research Center (CPTAC-960) provides a specific protocol for detecting phosphorylation at S24 of TMEM230 using an enrichment MRM approach with IMAC .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.