Recombinant Human UPF0444 transmembrane protein C12orf23 (C12orf23)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant C12orf23 is produced using diverse expression systems:

  • Bacterial systems: Full-length Xenopus laevis C12orf23 homolog A (1–114aa) fused to an N-terminal His tag in E. coli .

  • Mammalian systems: Human C12orf23 with C-terminal Myc-DDK tags in HEK293 cells .

  • Purity: ≥85% as verified by SDS-PAGE .

Table 3: Key Functional Interactions of C12orf23

Interaction PartnerMethod of DetectionBiological Role
GH1Co-immunoprecipitation Growth hormone signaling
BMP2Transcriptomic analysis Osteoblast differentiation
STAT5Phosphorylation assays GH/IGF-1 axis regulation

Research Applications

  • ELISA kits: Quantify C12orf23 in biological fluids (detection range: 0.156–10 ng/ml) .

  • Antibodies: Rabbit polyclonal anti-C12orf23 (TA333490) for Western blot and immunohistochemistry .

  • CRISPR models: Tmem263-KO mice for studying postnatal growth defects .

Challenges and Future Directions

While recombinant C12orf23 is critical for mechanistic studies, unresolved questions remain:

  • Structure-function relationship: How transmembrane domains mediate interactions with GH1 or ion channels.

  • Therapeutic potential: Feasibility of modulating C12orf23 to treat growth disorders or osteoporosis.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM263; C12orf23; Transmembrane protein 263
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-116
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM263
Target Protein Sequence
MNQTDKNQQEIPSYLNDEPPEGSMKDHPQQQPGMLSRVTGGIFSVTKGAVGATIGGVAWI GGKSLEVTKTAVTTVPSMGIGLVKGGVSAVAGGVTAVGSAVVNKVPLTGKKKDKSD
Uniprot No.

Target Background

Database Links

HGNC: 28281

KEGG: hsa:90488

UniGene: Hs.257664

Protein Families
TMEM263 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the current known functions of C12orf23/TMEM263?

Current research indicates that C12orf23/TMEM263 is involved in several important biological functions:

Loss-of-function mutations in C12orf23/TMEM263 have been associated with dwarfism in both chicken and mouse models, suggesting its crucial role in normal growth and development. Studies in humans have shown significant associations between C12orf23/TMEM263 and femoral neck bone mineral density (FN-BMD) .

How conserved is the C12orf23/TMEM263 protein across species?

The C12orf23/TMEM263 protein demonstrates remarkable conservation across various species, indicating its fundamental biological importance. Analysis of predicted reactivity across species shows:

SpeciesSequence Homology
Human100%
Cow100%
Dog100%
Guinea Pig100%
Horse100%
Rabbit100%
Mouse93%
Rat100%
Zebrafish79%

This high level of conservation across diverse vertebrate species suggests that TMEM263 serves an evolutionarily important function. Even Cape elephant shrew (Elephantulus edwardii) has a C12orf23 homolog, demonstrating the protein's ancient evolutionary history .

What expression systems are most effective for producing recombinant C12orf23/TMEM263?

For recombinant expression of human C12orf23/TMEM263, HEK293T cells have proven to be particularly effective. This mammalian expression system allows for proper post-translational modifications and folding of the transmembrane protein. The expression and purification methodology typically involves:

  • Transfection of HEK293T cells with C12orf23 cDNA expression vector

  • Cell culture for 48 hours post-transfection

  • Cell lysis using RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, with protease inhibitors)

  • Protein capture through anti-DDK (FLAG) affinity column

  • Further purification by conventional chromatography

  • Quality control by SDS-PAGE and Coomassie blue staining (purity >80%)

  • BCA method for protein concentration determination (typically >0.05 μg/μL)

The recombinant protein is most stable when stored at -80°C in buffer containing 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol. Repeated freeze-thaw cycles should be avoided to maintain protein integrity .

What antibodies are available for C12orf23/TMEM263 detection and what applications are they validated for?

Several antibodies against C12orf23/TMEM263 are available for research applications. A well-characterized example is a rabbit polyclonal antibody directed against the C-terminal region (amino acids 68-116) of human C12orf23. This antibody has been validated for:

  • Western Blotting (WB)

  • Immunofluorescence on both cultured cells (IF-cc) and paraffin sections (IF-p)

  • ELISA

  • Immunohistochemistry on frozen (IHC-fro) and paraffin sections (IHC-p)

The immunogen typically used is a synthetic peptide corresponding to the C-terminal region of human C12orf23, which provides specificity for the target. For optimal results in Western blotting, researchers should use freshly prepared lysates and optimize blocking conditions to minimize background .

What are the best methods for studying C12orf23/TMEM263 in cellular and tissue contexts?

For comprehensive investigation of C12orf23/TMEM263 in cellular and tissue contexts, a multi-method approach is recommended:

For cellular localization and expression:

  • Immunofluorescence microscopy using validated antibodies

  • Subcellular fractionation followed by Western blotting

  • GFP-fusion proteins for live-cell imaging

For tissue expression patterns:

  • RT-qPCR for mRNA quantification (validated primers: TMEM263_2F: 5′-GCCACCAGAAGGTTCAATCAAAG-3′; TMEM263_2R: 5′-CTGAAGATGCCACCAGTCACA-3′)

  • Immunohistochemistry on tissue sections

  • In situ hybridization for spatial mRNA expression

For functional studies:

  • CRISPR/Cas9-mediated gene knockout/knockdown

  • Overexpression using adeno-associated virus (AAV) particles

  • Co-immunoprecipitation to identify protein interaction partners

When studying growth-related functions, simultaneous assessment of GH1 and IGF-1 expression is recommended (for IGF-1: IGF1_F: 5′-CTTGAAGGTGAAGATGCACACTG-3′; IGF1_R: 5′-GGCAGCAGCAGAACTGGTTA-3′) .

How does C12orf23/TMEM263 influence the GH/IGF-1 signaling pathway?

C12orf23/TMEM263 appears to play a crucial role in the GH/IGF-1 axis through several mechanisms:

  • Direct interaction with GH1 (Growth Hormone 1): Protein-protein interaction studies using co-immunoprecipitation followed by mass spectrometry have demonstrated that TMEM263 physically interacts with GH1, suggesting a potential regulatory role in GH signaling.

  • Regulation of GHR expression: In Tmem263 knockout mice, there is a significant reduction in growth hormone receptor (GHR) gene expression in the liver, which consequently affects downstream IGF-1 production and secretion.

  • Impact on IGF-1 levels: Deletion of Tmem263 disrupts the GH/IGF-1 axis, leading to reduced serum IGF-1 levels and subsequent growth retardation.

  • Growth plate effects: Studies in Tmem263-null mice have shown alterations in growth plate morphology, which may be attributed to disrupted GH/IGF-1 signaling at the tissue level.

This multi-level involvement in the GH/IGF-1 pathway explains why mutations in TMEM263 lead to pronounced growth phenotypes such as dwarfism .

What phenotypes are associated with C12orf23/TMEM263 dysfunction in animal models?

Loss-of-function of C12orf23/TMEM263 in animal models leads to several distinct phenotypes:

In chicken models:

  • Autosomal dwarfism (adw) with approximately 30% growth reduction

  • Short shank phenotype

  • Nonsense mutation (p.Trp59*) in TMEM263 causes premature termination of the protein

In mouse models with Tmem263 deletion:

  • Significant reduction in body size and weight

  • Disrupted GH/IGF-1 axis

  • Reduced GHR expression in liver

  • Altered growth plate parameters

  • Low blood glucose and serum insulin levels

  • Potential effects on body adiposity and hepatic lipid content (requires further investigation)

The phenotypic consistency across species underscores the conserved function of TMEM263 in regulating growth across vertebrates .

What is known about C12orf23/TMEM263's role in bone development and mineral density?

C12orf23/TMEM263 has significant implications for bone development and mineral density:

  • Association with BMD: Human genome-wide association studies have identified significant associations between TMEM263 and femoral neck bone mineral density (FN-BMD).

  • Correlation with osteoblast activity: The expression level of TMEM263 strongly correlates with osteoblast functional modules (OFMs), which impact bone mineral density by influencing the activity of bone-forming osteoblasts.

  • Osteoporotic fracture risk: TMEM263 expression levels have been correlated with osteoporotic fracture risk, suggesting its potential as a biomarker for bone-related disorders.

  • Growth plate effects: In Tmem263-null mice, alterations in growth plate parameters have been observed, although specific details on age and sex differences in these effects require further investigation.

  • Potential influence on calcium metabolism: Given its role in bone development, TMEM263 may have broader implications for calcium homeostasis, though direct evidence for this requires additional research.

These findings collectively suggest that TMEM263 may influence bone development through modulation of osteoblast activity and potentially other mechanisms related to mineral deposition and bone formation .

How can epigenetic profiling enhance our understanding of C12orf23/TMEM263 regulation?

Epigenetic profiling offers valuable insights into C12orf23/TMEM263 regulation and function:

Recent epigenome-wide association studies (EWAS) have revealed differential DNA methylation at the TMEM263 locus in response to nutritional interventions, particularly vitamin K supplementation. The top responder differentially methylated region (DMR) in one study was identified in an enhancer upstream of the C12orf23/TMEM263 gene, suggesting epigenetic regulation may play a critical role in modulating TMEM263 expression.

Researchers investigating C12orf23/TMEM263 regulation should consider:

  • DNA methylation analysis: Bisulfite sequencing or methylation arrays to identify regulatory regions susceptible to methylation changes

  • Histone modification profiling: ChIP-seq for marks like H3K27ac, H3K4me3, and H3K27me3 at the TMEM263 locus

  • Chromatin accessibility assays: ATAC-seq to identify open chromatin regions that may contain regulatory elements

  • Integration with transcriptomics: Correlating epigenetic modifications with expression data to establish functional relationships

These approaches may reveal how environmental factors and metabolic conditions influence TMEM263 expression through epigenetic mechanisms, potentially explaining variability in growth phenotypes .

What are the implications of C12orf23/TMEM263's potential interaction with potassium channels?

Recent research has identified C12orf23/TMEM263 as an interaction partner of potassium channels Slick and Slack, which are sodium-activated channels widely expressed in the central nervous system. This finding opens several research avenues:

  • Neurological implications: The interaction suggests TMEM263 may have previously unrecognized functions in neuronal signaling and excitability.

  • Electrophysiological studies: Researchers should consider patch-clamp recordings in TMEM263-expressing cells to determine if it modulates potassium channel activity.

  • Subcellular co-localization: Immunofluorescence co-localization studies can confirm the spatial relationship between TMEM263 and potassium channels in neuronal tissues.

  • Structural interaction studies: Molecular modeling and mutation analysis could identify the specific domains mediating this interaction.

  • Potential growth-neural connections: Given TMEM263's established role in growth pathways, this interaction may represent a novel intersection between growth signaling and neuronal function.

These findings suggest that TMEM263 may function beyond growth regulation, potentially influencing neuronal activity through ion channel interactions, which could have broader implications for understanding both growth disorders and neurological functions .

What methodological approaches can resolve the mechanism by which C12orf23/TMEM263 affects GHR expression?

To elucidate the precise mechanism by which C12orf23/TMEM263 affects GHR expression, several complementary approaches are recommended:

  • Chromatin immunoprecipitation (ChIP): Determine if TMEM263 or its binding partners directly interact with GHR promoter or enhancer regions.

  • Transcription factor activity assays: Investigate if TMEM263 affects the activity of transcription factors known to regulate GHR expression.

  • RNA stability assays: Measure GHR mRNA half-life in the presence and absence of TMEM263 to determine if post-transcriptional regulation is involved.

  • Signaling pathway analysis: Use phospho-specific antibodies and kinase inhibitors to map the signaling cascades connecting TMEM263 to GHR expression.

  • Protein-protein interaction network mapping: Employ methods like BioID or proximity labeling to identify the complete interactome of TMEM263 in relevant tissues.

  • Tissue-specific conditional knockouts: Generate liver-specific, growth plate-specific, and other tissue-specific Tmem263 knockout models to dissect tissue-autonomous versus non-autonomous effects.

  • Single-cell transcriptomics: Apply scRNA-seq to identify cell populations most affected by TMEM263 deficiency and the earliest transcriptional changes preceding GHR downregulation.

These methodological approaches should be prioritized to establish the direct mechanistic link between TMEM263 and GHR expression, which remains a critical gap in our understanding of how TMEM263 regulates growth .

What are the potential applications of C12orf23/TMEM263 research in human health and disease?

Research on C12orf23/TMEM263 has several potential applications in human health and disease:

  • Growth disorders: Given its role in the GH/IGF-1 axis, TMEM263 variants could be screened in patients with idiopathic short stature or other growth disorders of unknown etiology.

  • Bone health and osteoporosis: The association with bone mineral density suggests TMEM263 could be a target for osteoporosis prevention or treatment, or serve as a biomarker for fracture risk.

  • Metabolic disorders: The observed impacts on glucose levels and potentially insulin signaling warrant investigation of TMEM263 in metabolic syndrome and related conditions.

  • Precision medicine approaches: Pharmacogenomic studies could examine if TMEM263 variants predict response to growth hormone therapy or bone-strengthening medications.

  • Therapeutic targeting: Based on structure-function studies, small molecule modulators of TMEM263 could be developed to enhance GH signaling in growth disorders.

  • Biomarker development: Expression or epigenetic marks at the TMEM263 locus might serve as biomarkers for predicting response to nutritional interventions affecting growth or bone health.

  • Developmental biology insights: Understanding TMEM263's role in the GH/IGF-1 axis can provide broader insights into the regulation of mammalian growth and development.

These applications underscore the importance of continued research on this relatively understudied transmembrane protein and its potential implications for multiple aspects of human health .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.