Recombinant Human UPF0458 protein C7orf42 (C7orf42)

Shipped with Ice Packs
In Stock

Description

Host Systems

Recombinant Human UPF0458 protein C7orf42 is produced in diverse hosts to optimize folding and post-translational modifications:

Host SystemExpression PlatformPurityApplicationsSource
E. coliBacterial expression>90% (SDS-PAGE)High-yield production, structural studies
HEK293 CellsMammalian expressionNot specifiedFunctional assays, IHC
Baculovirus/Insect CellsEukaryotic expression≥85% (SDS-PAGE)Post-translational modifications

Tagging and Purification

  • Tag: N-terminal His-tag (e.g., in E. coli systems) .

  • Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged proteins) .

Experimental Uses

  1. Western Blotting (WB): Detects TMEM248 expression in cell lysates or recombinant preparations .

  2. Immunohistochemistry (IHC): Localizes TMEM248 in tissue sections .

  3. ELISA: Quantifies protein levels in complex samples .

  4. Protein Interaction Studies: Identifies binding partners via co-immunoprecipitation or pull-down assays .

Biochemical Functions

  • Primary Function: Protein binding, as inferred from homology and interaction data .

  • Interacting Proteins: Includes SYNE4, PKD2, TAF1, and UBFD1 .

Involved Pathways

While specific pathways remain underexplored, TMEM248 is implicated in:

  • Protein Binding Networks: Interacts with cytoskeletal regulators (e.g., SYNE4) and transcription factors (e.g., TAF1) .

  • Cellular Signaling: Potential roles in kinase-mediated pathways (e.g., PKD2) .

Research Gaps and Future Directions

  • Functional Characterization: Limited data on enzymatic activity or disease associations.

  • Tissue-Specific Expression: Requires validation in human tissues.

  • Therapeutic Potential: Unexplored, but interaction with PKD2 (polycystic kidney disease) suggests possible links to nephrology research .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TMEM248; C7orf42; Transmembrane protein 248
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM248
Target Protein Sequence
MFSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEMAEDWNTFLL RFNDLDLCVSENETLKHLTNDTTTPESTMTSGQARASTQSPQALEDSGPVNISVSITLTL DPLKPFGGYSRNVTHLYSTILGHQIGLSGREAHEEINITFTLPTAWSSDDCALHGHCEQV VFTACMTLTASPGVFPVTVQPPHCVPDTYSNATLWYKIFTTARDANTKYAQDYNPFWCYK GAIGKVYHALNPKLTVIVPDDDRSLINLHLMHTSYFLFVMVITMFCYAVIKGRPSKLRQS NPEFCPEKVALAEA
Uniprot No.

Target Background

Database Links

HGNC: 25476

KEGG: hsa:55069

STRING: 9606.ENSP00000340668

UniGene: Hs.488478

Protein Families
TMEM248 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the functional characterization of Recombinant Human UPF0458 protein C7orf42?

Recombinant Human UPF0458 protein C7orf42 belongs to the UPF0458 protein family with poorly understood functions. Current evidence suggests potential roles in cellular signaling pathways and protein-protein interactions. Functional characterization typically involves activity assays similar to those used for other recombinant proteins, such as the serum response element luciferase reporter assay that measures cellular pathway activation. When investigating this protein, researchers should employ both computational prediction methods and experimental validation, including protein interaction studies, cellular localization experiments, and functional assays in relevant cell lines .

What are the optimal expression systems for producing Recombinant Human UPF0458 protein C7orf42?

The selection of an expression system depends on research objectives and downstream applications. For high-purity, animal-free production - similar to established recombinant proteins like EGF - bacterial systems (E. coli) can be used for basic structural studies, while mammalian expression systems (HEK293T, CHO cells) are preferred when post-translational modifications are critical. Each system has distinct advantages in terms of yield, purity, and functional activity, as shown in the comparative table below:

Expression SystemAdvantagesLimitationsTypical YieldBest For
E. coliHigh yield, cost-effectiveLimited post-translational modifications10-50 mg/LStructural studies
Mammalian (HEK293T)Native-like modificationsHigher cost, lower yield1-10 mg/LFunctional studies
Insect cellIntermediate complexity modificationsModerate cost5-20 mg/LBalance of yield and function
Cell-freeRapid productionVery low yield<1 mg/LQuick screening

For research applications requiring defined conditions, animal origin-free production systems should be considered, particularly for applications in stem cell biology .

What are the appropriate sample sizes for C7orf42 protein activity experiments?

Sample size determination should be based on statistical power calculations rather than convenience or resource limitations. For C7orf42 experiments, consider:

  • Effect size estimation: Based on preliminary data or similar proteins, estimate the expected magnitude of differences between experimental conditions

  • Desired statistical power: Typically 0.8 (80% chance of detecting a true effect)

  • Significance level: Commonly α = 0.05

  • Experimental design type: Within-subjects designs typically require fewer participants/samples than between-subjects designs

  • Variability: Higher variability in measurements requires larger sample sizes

For protein activity assays, a power analysis using the following formula can be applied:

n=2(Zα+Zβ)2σ2Δ2n = \frac{2(Z_\alpha + Z_\beta)^2\sigma^2}{\Delta^2}

Where:

  • n is the sample size per group

  • Zα is the standard normal deviate for significance level α

  • Zβ is the standard normal deviate for power 1-β

  • σ is the standard deviation

  • Δ is the minimum detectable difference

With typical protein activity assays, 3-5 biological replicates with 2-3 technical replicates per condition often provide sufficient statistical power, but formal calculations should be performed for each specific experimental scenario .

How do I establish appropriate positive and negative controls for C7orf42 functional studies?

Establishing appropriate controls is critical for interpreting results from C7orf42 functional studies. Consider implementing:

Positive Controls:

  • Known interacting proteins: Proteins with established interactions in the same pathway

  • Structurally similar proteins: Other UPF family proteins with characterized functions

  • Pathway activators: Known activators of predicted pathways where C7orf42 functions

Negative Controls:

  • Buffer-only conditions: Same buffer composition without protein

  • Heat-denatured protein: Same protein preparation after heat inactivation

  • Mutated variants: C7orf42 with mutations in predicted functional domains

  • Irrelevant proteins: Proteins of similar size but unrelated function

Each experimental condition should include controls processed identically to test samples. For cell-based assays, implement a blocked design where each experimental block contains all treatments and controls to minimize batch effects. Document and report all control results even when they perform as expected, as this validates experimental procedures .

What statistical approaches are appropriate for analyzing C7orf42 protein activity data?

The statistical approach should match your experimental design and research question. For C7orf42 protein activity data, consider:

For comparing multiple conditions:

  • Analysis of Variance (ANOVA): For factorial designs with multiple factors and levels

    • One-way ANOVA: When examining one factor (e.g., protein concentration)

    • Two-way ANOVA: When examining two factors (e.g., concentration and cell type)

    • Repeated measures ANOVA: For within-subjects designs with multiple measurements

For dose-response relationships:

  • Regression analysis: To model relationships between protein concentration and activity

  • EC50 determination: Using non-linear regression to calculate half-maximal effective concentration

For example, to analyze a standard protein activity assay similar to the EGF luciferase reporter assay mentioned in the search results, non-linear regression would be used to determine the EC50 value (concentration producing 50% of maximum response) .

For comparing experimental groups to controls:

  • t-tests with multiple comparison corrections (Bonferroni, Tukey, or Dunnett's specifically for comparing to a control)

  • Mixed effects models: For complex designs with both fixed and random effects

Always assess data normality before selecting parametric tests and consider transformation or non-parametric alternatives if assumptions are violated .

How do I determine the reproducibility and reliability of my C7orf42 protein research findings?

Establishing reproducibility and reliability requires multi-faceted approaches:

  • Internal validation:

    • Technical replicates: Repeat measurements of the same sample

    • Biological replicates: Independent biological samples under identical conditions

    • Calculate coefficient of variation (CV) between replicates (CV = standard deviation/mean × 100%)

    • Acceptable CV values should be <15% for protein activity assays

  • External validation:

    • Reproduce key findings using:

      • Different detection methods

      • Alternative cell lines/models

      • Independent protein preparations

  • Statistical reliability metrics:

    • Intraclass correlation coefficient (ICC) for test-retest reliability

    • Cronbach's alpha for internal consistency

    • Bland-Altman plots for agreement between methods

  • Experimental reporting:

    • Document detailed protocols following ARRIVE or similar guidelines

    • Report all statistical tests, exact p-values, and confidence intervals

    • Share raw data in public repositories

For example, protein activity data could be validated using both a luciferase reporter assay and orthogonal methods such as phosphorylation of downstream targets or transcriptional responses of target genes .

How should I handle contradictory or unexpected results in C7orf42 studies?

Contradictory or unexpected results should be approached systematically rather than dismissed:

  • Verification steps:

    • Repeat experiments with increased technical and biological replicates

    • Check reagent quality, including protein batch variation and degradation

    • Verify equipment calibration and experimental conditions

    • Review protocol execution for deviations

  • Expanded investigation:

    • Implement alternative assay methods to confirm or refute findings

    • Adjust experimental conditions (time points, concentrations, cell types)

    • Consider context-dependent factors (cell confluency, passage number, media composition)

  • Literature analysis:

    • Conduct comprehensive literature review for similar contradictions

    • Investigate if related proteins show context-dependent behaviors

  • Hypothesis refinement:

    • Develop alternative hypotheses that accommodate contradictory results

    • Design targeted experiments to test revised hypotheses

  • Transparent reporting:

    • Document and report contradictory results

    • Discuss possible explanations and limitations

    • Avoid publication bias by reporting negative findings

Unexpected results often lead to novel discoveries, particularly with poorly characterized proteins like C7orf42. The UPF0458 family may have context-dependent functions that only emerge under specific experimental conditions .

What are effective strategies for investigating protein-protein interactions involving C7orf42?

Investigating protein-protein interactions for poorly characterized proteins like C7orf42 requires multiple complementary approaches:

  • Computational prediction:

    • Sequence-based prediction tools (STRING, IntAct)

    • Structural homology modeling

    • Domain-based interaction prediction

  • In vitro interaction assays:

    • Pull-down assays with purified recombinant proteins

    • Surface Plasmon Resonance (SPR) for binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • Cell-based interaction studies:

    • Co-immunoprecipitation (Co-IP)

    • Proximity Ligation Assay (PLA)

    • Förster Resonance Energy Transfer (FRET)

    • Bimolecular Fluorescence Complementation (BiFC)

  • High-throughput screening:

    • Yeast two-hybrid (Y2H) screens

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • BioID or APEX proximity labeling

A multi-method validation approach is essential, as each technique has distinct strengths and limitations. For example, interactions detected by Y2H should be confirmed by Co-IP and/or in vitro binding assays. Detected interactions should be characterized for their specificity, affinity (Kd values), and biological relevance through functional studies .

How can I design experiments to elucidate the role of C7orf42 in cellular pathways?

Elucidating the role of C7orf42 in cellular pathways requires a systematic approach integrating multiple experimental strategies:

  • Loss-of-function studies:

    • CRISPR-Cas9 gene knockout

    • siRNA/shRNA-mediated knockdown

    • Analysis of global gene expression changes (RNA-seq)

    • Phosphoproteomics to identify altered signaling pathways

  • Gain-of-function studies:

    • Overexpression of wild-type C7orf42

    • Expression of constitutively active variants

    • Domain-specific mutants to dissect function

  • Pathway-focused investigations:

    • Receptor activation assays

    • Phosphorylation status of pathway components

    • Transcriptional reporter assays for pathway activation

    • Real-time signaling using biosensors

  • Cellular phenotype analysis:

    • Proliferation and cell cycle progression

    • Differentiation capacity

    • Migration and invasion properties

    • Stress response characteristics

Design these experiments as a factorial study examining multiple cell types and conditions. Implement a 2×2×2 design examining C7orf42 expression levels (normal vs. altered), pathway stimulation (with vs. without stimulus), and cellular context (normal vs. stressed conditions). This design allows for identification of context-dependent functions and pathway crosstalk .

What approaches can determine the structural and functional domains of the C7orf42 protein?

Determining structural and functional domains requires integrated computational and experimental approaches:

  • Computational domain prediction:

    • Sequence-based domain prediction (SMART, Pfam, InterPro)

    • Secondary structure prediction (PSIPRED, JPred)

    • Disorder prediction (PONDR, IUPred)

    • Homology modeling based on related structures

  • Experimental structure determination:

    • X-ray crystallography of full-length protein or domains

    • Nuclear Magnetic Resonance (NMR) for flexible regions

    • Cryo-electron microscopy for larger complexes

    • Small-angle X-ray scattering (SAXS) for solution structure

  • Functional domain mapping:

    • Truncation mutants series testing specific domains

    • Site-directed mutagenesis of predicted functional residues

    • Domain swapping with related proteins

    • Limited proteolysis to identify stable domains

  • Biophysical characterization:

    • Circular dichroism (CD) for secondary structure content

    • Differential scanning fluorimetry (DSF) for stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) for oligomeric state

The results from these approaches should be integrated to create a comprehensive structure-function map. For example, if computational analysis predicts a kinase-like domain, experiments should test ATP binding, substrate phosphorylation, and the effects of mutations in predicted catalytic residues .

How do I formulate testable research questions about C7orf42 protein function?

Developing strong research questions about poorly characterized proteins like C7orf42 requires particular attention to focus, feasibility, and relevance. An effective research question should:

  • Be specific and focused rather than overly broad:

    • Poor question: "What is the function of C7orf42?"

    • Improved question: "How does C7orf42 affect cell migration in neural progenitor cells?"

  • Be based on existing literature even when limited:

    • Poor question: "Does C7orf42 have any cellular effects?"

    • Improved question: "Does C7orf42, which shares structural homology with known regulators of cell division, influence mitotic progression in rapidly dividing cells?"

  • Be realistic in time, scope, and budget:

    • Poor question: "What are all possible interaction partners of C7orf42 in every human tissue?"

    • Improved question: "What are the primary interaction partners of C7orf42 in HEK293T cells under normal and serum-starved conditions?"

  • Be sufficiently in-depth to warrant substantial investigation:

    • Poor question: "Is C7orf42 expressed in brain tissue?"

    • Improved question: "How does the expression pattern of C7orf42 change during neural differentiation, and what upstream factors regulate its expression?"

  • Be testable with clear metrics for evaluation:

    • Poor question: "Is C7orf42 important for cellular health?"

    • Improved question: "How does CRISPR-mediated knockout of C7orf42 affect proliferation rates, apoptosis markers, and metabolic profiles in human fibroblasts?"

What experimental controls are essential when working with novel or poorly characterized proteins like C7orf42?

When working with novel proteins like C7orf42, rigorous controls are crucial to distinguish genuine findings from artifacts:

  • Expression vector controls:

    • Empty vector controls

    • GFP or other tag-only controls

    • Irrelevant protein expressed from same vector

  • Protein quality controls:

    • SDS-PAGE with Coomassie staining for purity assessment

    • Western blotting to confirm identity

    • Mass spectrometry verification

    • Activity controls with known function proteins

  • Antibody validation controls:

    • Pre-immune serum controls

    • Isotype controls

    • Antigenic peptide blocking

    • Knockout/knockdown cell lines

  • Experimental process controls:

    • No-treatment controls

    • Vehicle controls

    • Time-matched controls

    • Randomized block design to control for batch effects

  • Biological context controls:

    • Multiple cell types or tissues

    • Different physiological states

    • Developmental stage comparisons

For activity assays, establish a clear dose-response relationship similar to the approach used with EGF protein, where activity is determined through serial dilutions and pathway activation measures with appropriate normalization controls .

How can I design experiments to distinguish the specific effects of C7orf42 from general cellular responses?

Distinguishing specific effects from general responses requires carefully designed experiments:

  • Specificity controls:

    • Parallel experiments with structurally similar but functionally distinct proteins

    • Dose-response relationships (specific effects typically show saturation)

    • Competitive inhibition with excess unlabeled protein

    • Mutant variants with selective functional deficiencies

  • Temporal resolution:

    • Time-course experiments to distinguish primary from secondary effects

    • Pulse-chase designs to track immediate responses

    • Inducible expression systems for temporal control

  • Spatial resolution:

    • Subcellular localization studies

    • Compartment-restricted expression

    • FRET-based proximity sensors

  • Pathway dissection:

    • Selective pathway inhibitors

    • Genetic knockout of potential downstream mediators

    • Reconstitution experiments in simplified systems

  • Multi-omics approach:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Network analysis to identify C7orf42-specific nodes

    • Comparison with datasets from related perturbations

For example, a well-designed experiment might use a 3×3 factorial design examining C7orf42 (wild-type, mutant, control protein) across three cell states (normal, stressed, differentiated), with readouts at multiple time points (10 min, 1 hour, 24 hours) to distinguish immediate from adaptive responses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.