Recombinant Human Small integral membrane protein 4 (SMIM4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Complex III Assembly

SMIM4 is an integral inner mitochondrial membrane (IMM) protein critical for early-stage assembly of cytochrome c reductase (Complex III) . It interacts with:

  • Mitochondrial ribosomes: Associates with the 28S small subunit (mtSSU) and 39S large subunit (mtLSU) .

  • Assembly factors: Binds UQCC1, UQCC2, and C12ORF73, facilitating coordination between cytochrome b (CytB) translation and Complex III assembly .

  • Quality control machinery: Links to proteases (YME1L, AFG3L2) and membrane scaffolds (SLP2, PHB1) .

Mechanistic Insights

  • SMIM4 depletion reduces Complex III levels by ~38% and impairs cell growth by 50% .

  • It stabilizes C12ORF73, whose loss reciprocally destabilizes SMIM4, indicating co-dependency .

Production and Purification

Recombinant SMIM4 is produced in E. coli systems, enabling high-yield purification for structural and functional studies .

Complex III Biogenesis Studies

Recombinant SMIM4 enables:

  • Mapping interactions via co-immunoprecipitation and SILAC-based proteomics .

  • Structural analysis of early assembly intermediates using BN-PAGE and cryo-EM .

Disease Modeling

  • CRISPR/Cas9-generated SMIM4 knockout HeLa cells (1 bp insertion in exon 1) show defective Complex III activity and growth retardation .

  • Links to mitochondrial disorders are under investigation, given SMIM4’s role in OXPHOS .

Comparative Analysis of SMIM4 Isoforms

SpeciesRecombinant ProductHost SystemKey Use Case
HumanFull-length SMIM4 (1-70aa) with His tag E. coliInteraction studies
MousePartial SMIM4 (UniProt: Q8K2C3) Mammalian cellsCross-species comparisons

Key Research Findings

  1. Ribosome Interaction: SMIM4 co-purifies with mitochondrial ribosomes, suggesting a role in co-translational assembly of CytB .

  2. Early Assembly Role: SMIM4 associates with nascent CytB but dissociates before later stages (e.g., Rieske protein incorporation) .

  3. Quality Control Link: SMIM4 interacts with proteases YME1L and AFG3L2, coupling assembly with misfolded protein degradation .

Future Directions

  • Structural resolution of SMIM4-C12ORF73 complexes.

  • Investigating SMIM4 mutations in mitochondrial encephalopathies.

  • Optimizing recombinant SMIM4 for drug screening targeting OXPHOS defects.

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used prior to lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare your order according to your preference.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
SMIM4; C3orf78; Small integral membrane protein 4
Datasheet & Coa
Please contact us to get it.
Expression Region
1-70aa
Mol. Weight
11.5 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Others
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
SMIM4
Target Protein Sequence
MFTRAQVRRILQRVPGKQRFGIYRFLPFFFVLGGTMEWIMIKVRVGQETFYDVYRRKASERQYQRRLEDE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Database Links

HGNC: 37257

KEGG: hsa:440957

UniGene: Hs.660577

Protein Families
SMIM4 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is SMIM4 and where is it localized in human cells?

SMIM4 is a small integral membrane protein containing one predicted transmembrane domain (amino acids 20-41). It localizes to mitochondria as demonstrated by STED super-resolution light microscopy using antibody labeling. Submitochondrial localization experiments including hypo-osmotic swelling and carbonate extraction reveal that SMIM4 is an integral protein of the inner mitochondrial membrane (IMM) with its C-terminus facing the intermembrane space (IMS) .

What is the primary function of SMIM4 in mitochondria?

SMIM4 functions as a mitochondrial ribosome-associated protein that links translation to respiratory chain complex assembly. It particularly contributes to the biogenesis of cytochrome c reductase (complex III) by interacting with early assembly factors including UQCC1, UQCC2, and C12ORF73. Knockdown studies show that SMIM4 depletion leads to a significant reduction of cytochrome c reductase to approximately 62% of normal levels, confirming its role in complex III biogenesis .

How can researchers detect and visualize SMIM4 in cellular studies?

Researchers can detect SMIM4 using:

  • Epitope tagging: Generation of stable cell lines with inducible expression of FLAG-tagged SMIM4

  • Immunofluorescence: STED super-resolution microscopy with appropriate antibodies

  • Subcellular fractionation: Combined with western blotting to assess submitochondrial localization

  • Proteinase K accessibility assays: To determine membrane topology

  • Carbonate extraction: To confirm integration into the membrane vs. peripheral association

What experimental systems are suitable for studying SMIM4 function?

HEK293T cells have been successfully used for SMIM4 studies, including the generation of stable inducible expression lines. Both glucose and galactose-containing media can be used for growth assessments, with galactose media being particularly useful for revealing respiratory chain defects. siRNA-mediated knockdown approaches have proven effective for functional studies, with cell viability and growth measurements providing quantifiable phenotypes .

How does SMIM4 interact with the mitochondrial translation machinery?

SMIM4 has been identified as a mitochondrial ribosome-associated protein through mass spectrometric analysis. It interacts with components of both the 28S mtSSU (small subunit) and 39S mtLSU (large subunit) of the mitochondrial ribosome. This association suggests that SMIM4 may function at the interface between mitochondrial translation and the early assembly of respiratory chain complexes, particularly complex III. Quantitative proteomics approaches using SILAC labeling can identify specific ribosomal components that associate with SMIM4 .

What is the relationship between SMIM4 and C12ORF73 in complex III biogenesis?

SMIM4 and C12ORF73 exhibit functional interdependence. Knockdown experiments demonstrate that:

  • SMIM4 levels decrease in C12ORF73-depleted cells

  • C12ORF73 levels decrease in SMIM4-depleted cells

  • Both proteins interact with early cytochrome c reductase assembly factors

  • Knockdown of either protein results in significant reduction of complex III levels

  • Both proteins are required for optimal cell growth, with depletion leading to approximately 50% reduction in cell numbers after 72 hours

This suggests that SMIM4 and C12ORF73 function together in a complex or pathway essential for the early stages of complex III assembly.

How can researchers quantitatively assess SMIM4's impact on respiratory chain complex assembly?

Researchers can quantitatively assess SMIM4's impact through:

  • Blue Native PAGE (BN-PAGE) analysis of mitochondrial complexes following SMIM4 depletion

  • Immunoblotting of BN-PAGE gels with antibodies against specific respiratory complex subunits

  • Densitometric quantification of complex band intensities normalized to loading controls

  • Statistical analysis of multiple biological replicates (e.g., using one-sample t-test)

  • Complementation experiments to confirm specificity of observed defects

This approach has demonstrated that SMIM4 knockdown results in a significant reduction of cytochrome c reductase to 62% of control levels .

What methods can be used to identify the complete interactome of SMIM4?

The SMIM4 interactome can be identified using:

  • Affinity purification coupled with mass spectrometry:

    • SILAC-based quantitative proteomics using FLAG-tagged SMIM4

    • Mitochondrial isolation followed by FLAG immunoprecipitation

    • LC-MS/MS analysis using high-resolution instruments (e.g., Orbitrap Elite)

    • Data analysis with MaxQuant/Andromeda software

    • Minimum requirements: one unique peptide and one SILAC peptide pair for identification

    • Include label-switch replicates for robust quantification

  • Validation using targeted approaches:

    • Immunoblotting of purified complexes

    • Reciprocal immunoprecipitation

    • Proximity labeling techniques

What is the impact of SMIM4 depletion on mitochondrial respiration and cellular bioenergetics?

When SMIM4 is depleted using siRNA-mediated knockdown, several bioenergetic consequences occur:

  • Significant reduction in cell growth (to approximately 50% of control) in both glucose and galactose media

  • Selective reduction of cytochrome c reductase (complex III) to 62% of normal levels

  • Possible minor effects on other OXPHOS complexes (though statistically insignificant in current studies)

These findings suggest that SMIM4 specifically affects cellular bioenergetics through its role in complex III assembly. Further investigations using oxygen consumption measurements, membrane potential assessments, and metabolic analyses would provide more comprehensive understanding of SMIM4's impact on mitochondrial function .

What controls should be included when studying SMIM4 knockdown effects?

When studying SMIM4 knockdown effects, researchers should include:

  • Non-targeting siRNA controls (siNT)

  • Multiple independent siRNAs targeting SMIM4 to control for off-target effects

  • Rescue experiments with siRNA-resistant SMIM4 constructs

  • Both glucose and galactose media conditions to reveal respiratory defects

  • Time-course experiments to distinguish primary from secondary effects

  • Equal loading controls for protein analysis (verified by SDS-PAGE)

  • Statistical analysis of multiple biological replicates

How can researchers distinguish between direct and indirect effects of SMIM4 on complex III biogenesis?

To distinguish direct from indirect effects:

  • Analyze the temporal sequence of events following SMIM4 depletion

  • Perform pulse-chase experiments to track newly synthesized mitochondrial-encoded proteins

  • Analyze assembly intermediates using two-dimensional native/SDS-PAGE

  • Perform crosslinking studies to identify direct interaction partners

  • Compare the interactomes of SMIM4 and known complex III assembly factors

  • Analyze the impact on specific assembly steps using established markers for intermediate complexes

What experimental approaches can identify the functional domains of SMIM4?

Researchers can identify functional domains of SMIM4 through:

  • Mutagenesis of the predicted transmembrane domain (amino acids 20-41)

  • Truncation constructs to identify minimal functional regions

  • Domain swapping with related proteins

  • Site-directed mutagenesis of conserved residues

  • Crosslinking and proximity labeling to map interaction surfaces

  • Structural studies (if protein can be purified in sufficient quantities)

  • Complementation assays in SMIM4-depleted cells to assess functionality of variants

How should mass spectrometry data from SMIM4 interaction studies be analyzed?

Mass spectrometry data from SMIM4 interaction studies should be analyzed using:

  • Raw data processing:

    • MaxQuant/Andromeda software (or similar tools)

    • Database search against UniProt human proteome set including isoforms

    • Parameter settings: minimum one unique peptide and one SILAC peptide pair

    • Fixed modifications: carbamidomethylation of cysteine

    • Variable modifications: N-terminal acetylation and oxidation of methionine

    • Enable "match between runs" and "requantify" options

  • Quantitative analysis:

    • Calculate enrichment ratios between experimental and control samples

    • Perform statistical analysis across biological replicates

    • Create volcano plots to visualize significance and fold change

    • Apply appropriate thresholds for significant interactions

    • Validate key interactions by orthogonal methods

How can researchers integrate SMIM4 findings with broader mitochondrial biology?

To integrate SMIM4 findings with broader mitochondrial biology:

  • Compare SMIM4 interactome with other mitochondrial ribosome-associated proteins

  • Position SMIM4 within known complex III assembly pathways

  • Investigate potential connections to mitochondrial quality control (given interactions with proteases)

  • Examine potential links between translation and respiratory chain assembly

  • Assess evolutionary conservation of SMIM4 function across species

  • Investigate potential roles in mitochondrial diseases with complex III deficiency

  • Examine SMIM4 regulation under different metabolic and stress conditions

What are the implications of SMIM4's interaction with mitochondrial quality control proteins?

SMIM4 interacts with several mitochondrial quality control components including:

  • The m-AAA protease (AFG3L2 and SPG7)

  • The i-AAA protease (YME1L)

  • Membrane scaffolds (SLP2)

  • Prohibitins (PHB1 and PHB2)

These interactions suggest SMIM4 may function at the intersection of complex III assembly and quality control. Future research should investigate:

  • Whether these proteases regulate SMIM4 stability or activity

  • If SMIM4 helps recruit quality control machinery to nascent or misfolded complex III components

  • How these interactions are regulated under different cellular conditions

  • Whether SMIM4 plays a role in mitochondrial stress responses

  • If manipulating these interactions could enhance mitochondrial function in disease models

How might SMIM4 contribute to human mitochondrial disease?

Given SMIM4's role in complex III biogenesis, it may contribute to human mitochondrial disease through:

  • Potential mutations in SMIM4 leading to complex III deficiency

  • Altered SMIM4 expression or function in known complex III disorders

  • Interactions with disease-associated complex III assembly factors

  • Impact on cellular bioenergetics relevant to mitochondrial dysfunction

  • Potential compensatory mechanisms that could be therapeutically targeted

Researchers should consider screening mitochondrial disease patients with complex III deficiency for SMIM4 mutations or expression changes, and investigate SMIM4 as a potential therapeutic target .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.