Recombinant Human UPF0668 protein C10orf76 (C10orf76)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Production

Recombinant C10orf76 is produced using bacterial (E. coli) or insect cell (Spodoptera frugiperda) systems, often with His-tagged purification.

Expression SystemTagPuritySource
E. coliHis>90% (SDS-PAGE) (Xenopus)
Sf9 cellsHisPurified via Ni-NTA (human)

Key Observations:

  • Stoichiometry: Forms a 1:1 complex with PI4KB, confirmed by size-exclusion chromatography .

  • Biochemical Activity: In vitro, C10orf76 inhibits PI4KB activity (IC₅₀ ~90 nM), but this effect is context-dependent in vivo .

Viral Replication Studies

C10orf76-dependent enteroviruses hijack the C10orf76-PI4KB complex to establish replication organelles.

VirusC10orf76 DependencyMechanism
Coxsackievirus A10EssentialDirect interaction with viral 3A protein
PoliovirusPartial requirementSynergistic with GBF1 recruitment
CVB1/CVB3Not requiredRelies on ACBD3/GBF1 pathways

Critical Mutation Studies:

  • Binding-Disrupting Mutants: Disrupting the c10orf76-PI4KB interface (e.g., PI4KB Δ486–498) abolishes Golgi recruitment of c10orf76 and viral replication .

  • Phosphorylation Effects: PKA-mediated Ser496 phosphorylation reduces c10orf76-PI4KB affinity (Kd shifts from 36 nM to 85 nM) .

Arf1 and PI4P Dynamics

C10orf76 knockout cells exhibit:

  • Reduced Golgi PI4P levels (visualized via anti-PI4P antibodies) .

  • Disrupted Arf1 Activation: Altered GBF1 localization and COP-I/II effector recruitment, despite intact Golgi morphology .

Hydrogen-Deuterium Exchange (HDX) Insights

HDX-MS revealed regions of PI4KB protected by c10orf76 binding:

PI4KB RegionDeuterium ProtectionFunctional Impact
N-lobe linker (486–498)Strong protection (>80%)Mediates c10orf76 binding and membrane recruitment
Helical domain (131–164)Moderate protectionOverlaps with Rab11 binding site
C-lobe (738–765)Weak protectionAdjacent to catalytic activation loop

Ceramide Transport Studies

Overexpression of HA-C10orf76 in ACBD3/C10orf76 double-knockout cells restores lysenin sensitivity, indicating compensation for ACBD3 in CERT-mediated ceramide transport .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ARMH3; C10orf76; Armadillo-like helical domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-689
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
C10orf76
Target Protein Sequence
MAQVEKRGGLLRKSSASKKPLKEKVVLMYDEIFMTEDPSKCSPRFWEELFLMKVNLEYLE GKLESLDGEELMKIKDNINCLFQHCIQALGEEHPIRVVNALQTLCALIRGVHQKNKSTSG FDIINMLMGFDKAELCMKNLMESLDSLLCAEGSESLKSLCLKLLLCLVTVTDNISQNTIL EYVMINSIFEAILQILSHPPSRREHGYDAVVLLALLVNYRKYESVNPYIVKLSIVDDEAT LNGMGLVIAQALSEYNRQYKDKEEEHQSGFFSALTNMVGSMFIADAHEKISVQTNEAILL ALYEAVHLNRNFITVLAQSHPEMGLVTTPVSPAPTTPVTPLGTTPPSSDVISSVELPLDA DVQTSNLLITFLKYSSIVMQDTKDEHRLHSGKLCLIILTCIAEDQYANAFLHDDNMNFRV NLHRMPMRHRKKAADKNLPCRPLVCAVLDLMVEFIVTHMMKEFPMDLYIRCIQVVHKLLC YQKKCRVRLHYTWRELWSALINLLKFLMSNETVLLAKHNIFTLALMIVNLFNMFITYGDT FLPTPSSYDELYYEIIRMHQSFDNLYSMVLRLSTNAGQWKEAASKVTHALVNIRAIINHF NPKIESYAAVNHISQLSEEQVLEVVRANYDTLTLKLQDGLDQYERYSEQHKEAAFFKELV RSISTNVRRNLAFHTLSQEVLLKEFSTIS
Uniprot No.

Target Background

Function

Recombinant Human UPF0668 protein C10orf76 (C10orf76) is involved in GBF1 recruitment, Golgi maintenance, and protein secretion.

Database Links

HGNC: 25788

KEGG: hsa:79591

STRING: 9606.ENSP00000359050

UniGene: Hs.16004

Protein Families
UPF0668 family
Subcellular Location
Golgi apparatus membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is the basic function of C10orf76 in human cells?

C10orf76 functions as a PI4KB-associated protein that regulates phosphatidylinositol 4-phosphate (PI4P) levels at the Golgi apparatus. It forms a direct, high-affinity complex with Phosphatidylinositol 4-Kinase Beta (PI4KB) and has been shown to influence membrane trafficking pathways. The protein has also been identified as essential for the viral replication of specific enteroviruses, highlighting its significance in host-pathogen interactions .

How does C10orf76 interact with PI4KB at the molecular level?

C10orf76 forms a direct, high-affinity complex with PI4KB through an extensive protein-protein interface. Size-exclusion chromatography experiments demonstrate that C10orf76 (79 kDa) and PI4KB (89 kDa) form a 1:1 stoichiometric complex with a combined molecular weight of approximately 158 kDa. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) has revealed that this interaction involves a disorder-to-order transition of the PI4KB N-lobe linker, creating an extended interface along the membrane-facing surface of the kinase .

What is known about the structure of human C10orf76?

While a complete high-resolution structure of C10orf76 has not been reported in the search results, functional studies indicate that C10orf76 contains specific binding interfaces that mediate interaction with PI4KB. The protein is conserved evolutionarily back to teleost fishes, suggesting fundamental cellular importance. C10orf76 possesses regulatory sites including Ser496, which is phosphorylated by Protein Kinase A (PKA), modulating its interaction with PI4KB .

What expression systems are most effective for producing recombinant human C10orf76?

Based on published methodologies, both insect cell and bacterial expression systems have been successfully employed for C10orf76 production. For high-quality functional studies:

  • Baculovirus-infected Spodoptera frugiperda (Sf9) cells provide an effective eukaryotic expression system that facilitates proper folding and potential post-translational modifications.

  • Escherichia coli strain Rosetta (DE3) has also been used successfully for C10orf76 expression, typically with induction at low temperatures (16°C) with 0.1 mM IPTG to enhance protein solubility .

The choice between these systems depends on the specific experimental requirements, with insect cells potentially providing more native-like protein modifications.

What purification strategy yields the highest activity for recombinant C10orf76?

A recommended purification strategy includes:

  • Expression with an N-terminal 6×His-tag followed by a TEV protease cleavage site

  • Initial capture using Ni-NTA affinity chromatography

  • Optional TEV protease treatment to remove the His-tag

  • Further purification via size-exclusion chromatography to isolate monomeric protein

It's important to note that apo C10orf76 (without binding partners) elutes from size-exclusion columns at a volume consistent with monomeric protein (79 kDa), while the C10orf76-PI4KB complex elutes at a volume corresponding to the expected 168 kDa 1:1 complex .

How can researchers measure the effect of C10orf76 on PI4KB activity?

The standard method to assess C10orf76's effect on PI4KB activity involves biochemical membrane reconstitution assays using phosphatidylinositol (PI) vesicles. A typical experimental approach includes:

  • Preparation of lipid vesicles containing phosphatidylinositol (either pure PI or mixed composition mimicking Golgi membranes)

  • Incubation of recombinant PI4KB with varying concentrations of C10orf76

  • Measurement of PI4P production via appropriate detection methods

Using this method, researchers have determined that C10orf76 inhibits PI4KB in a dose-dependent manner with an IC50 of approximately 90 nM in vitro. This inhibition occurs on both pure PI vesicles and mixed-composition vesicles that mimic Golgi membranes (20% PI, 10% PS, 45% PE, 25% PC) .

What methods can be used to study the C10orf76-PI4KB interaction?

Multiple complementary approaches can be employed to characterize the C10orf76-PI4KB interaction:

TechniqueApplicationKey Information Obtained
His-pulldown assaysBinding studiesDirect interaction verification
Size-exclusion chromatographyComplex formationStoichiometry of complex (1:1)
Hydrogen-deuterium exchange mass spectrometry (HDX-MS)Interface mappingProtected regions, conformational changes
Isothermal titration calorimetry (ITC)Binding affinityQuantitative Kd measurements
Mutagenesis studiesInterface validationCritical residues for binding

For detailed binding affinity measurements, HDX-MS provides a powerful method by plotting differences in deuterium incorporation against C10orf76 concentration, generating characteristic binding isotherms that can reveal changes in affinity (e.g., between phosphorylated and non-phosphorylated forms of PI4KB) .

How do researchers explain the paradox between C10orf76's inhibitory effect on PI4KB in vitro versus its positive regulation of PI4P levels in cells?

This represents a classic case of biochemical versus cellular complexity. The paradox can be approached through several hypotheses:

  • Cofactor hypothesis: The in vitro biochemical assays likely lack other PI4KB regulators present in cells, such as Arf1/GBF1 or ACBD3, which may alter the functional outcome of the C10orf76-PI4KB interaction.

  • Phosphatidylinositol dynamics: C10orf76 may alter phosphatidylinositol dynamics through interactions with phosphatidylinositol transfer proteins (PITPs), which are known to activate PI4KB activity.

  • Conformational regulation: In cells, C10orf76 may interact with other Golgi factors that induce a non-inhibitory conformation with PI4KB, converting it from an inhibitor to an activator.

  • Arf1 regulation: C10orf76 knockout leads to altered Arf1/GBF1 dynamics, which may indirectly affect PI4P levels through complex regulatory networks .

How does phosphorylation regulate the C10orf76-PI4KB complex?

C10orf76-PI4KB interaction is regulated by PKA-mediated phosphorylation at Ser496 of PI4KB. This site is conserved evolutionarily and has been identified in system-level analyses of PKA signaling networks. Experimental data reveals:

  • Phosphorylation of Ser496 decreases the binding affinity between C10orf76 and PI4KB by 2-3 fold (Kd shifts from approximately 36 nM to 85 nM).

  • This effect was confirmed by both HDX-MS and isothermal titration calorimetry measurements.

  • Phosphorylation does not directly affect the basal lipid kinase activity of PI4KB.

  • Interestingly, phosphomimetic mutations (S496D and S496E) failed to replicate the phosphorylation-dependent reduction in affinity, highlighting the limitations of this experimental approach .

What techniques can effectively visualize C10orf76 localization in human cells?

For visualizing C10orf76 localization in human cells, researchers can employ:

  • Immunofluorescence microscopy using antibodies against endogenous C10orf76 or epitope tags (like FLAG or HA) on recombinant constructs.

  • Live-cell imaging with fluorescent protein fusions (GFP, mCherry, etc.) to monitor dynamic localization.

  • Co-localization studies with established Golgi markers such as Giantin (cis/medial Golgi), GM130 (cis Golgi), TGN46 (trans-Golgi network), and ERGIC53 (ER-Golgi intermediate compartment).

Research has shown that C10orf76 localizes to the Golgi apparatus in a PI4KB-dependent manner, with mutations that disrupt the C10orf76-PI4KB interface preventing proper Golgi localization of C10orf76 .

How does C10orf76 influence membrane trafficking and Golgi structure?

  • C10orf76 affects Arf1 dynamics, with knockout cells showing increased cytosolic fractions of the Arf GEF GBF1 and active Arf1 effectors.

  • Despite these alterations, markers for different Golgi compartments (Giantin, ACBD3, GM130, TGN46, ERGIC53) maintain normal localization patterns in C10orf76 knockout cells, indicating preserved Golgi structure.

  • C10orf76 knockout cells show decreased PI4P levels at the Golgi, despite an apparent increase in Golgi-localized PI4KB, suggesting that C10orf76 regulates PI4KB activity rather than localization .

How does C10orf76 contribute to enterovirus replication?

C10orf76 has been identified as essential for the replication of specific enteroviruses, with a mechanism involving:

  • Formation of viral replication organelles requiring PI4P generation

  • C10orf76-dependent alterations in Arf1 dynamics and PI4P levels

  • Differential requirements among enterovirus species

The importance of C10orf76 varies by virus type:

  • Coxsackie virus A10 shows strong dependence on C10orf76

  • Poliovirus shows partial dependence on C10orf76

  • Coxsackie virus B1 and B3 replicate independently of C10orf76

What experimental approaches can determine if a specific virus depends on C10orf76 for replication?

To assess viral dependency on C10orf76, researchers can employ:

  • CRISPR-Cas9 knockout studies: Generate C10orf76-deficient cell lines and measure viral replication efficiencies

  • Interface disruption experiments: Introduce mutations that specifically disrupt the C10orf76-PI4KB interface to distinguish between general C10orf76 functions and those specifically dependent on PI4KB interaction

  • Viral replication assays: Measure viral RNA replication, protein synthesis, and infectious particle production in the presence or absence of functional C10orf76

  • Rescue experiments: Re-express wild-type or mutant C10orf76 in knockout cells to confirm specificity and identify critical functional domains

These approaches have revealed that viruses like coxsackie virus A10 require both C10orf76 and an intact C10orf76-PI4KB interface for efficient replication .

How can researchers generate C10orf76 mutants that specifically disrupt PI4KB binding?

  • Use HDX-MS data to identify regions protected from exchange upon complex formation, which indicate interaction surfaces

  • Focus on highly conserved residues within these protected regions, as these are likely critical for the interaction

  • Generate alanine substitutions or charge reversal mutations at these positions

  • Validate mutants through binding assays (pull-downs, ITC) and functional assays

What experimental controls are critical when studying the C10orf76-PI4KB complex?

When designing experiments to study the C10orf76-PI4KB complex, critical controls include:

  • Protein quality controls: Size-exclusion chromatography profiles to ensure monomeric, properly folded proteins

  • Binding interface validation: Multiple, complementary binding assays (pull-downs, ITC, HDX-MS) to confirm interactions

  • Mutational controls: Both binding-deficient mutants and phosphorylation-deficient mutants (S496A) to distinguish between different regulatory mechanisms

  • Cellular localization controls: Multiple Golgi markers (Giantin, GM130, TGN46, ERGIC53) to distinguish effects on specific Golgi compartments versus general Golgi disruption

  • Phosphorylation controls: Comparison of phosphorylated and non-phosphorylated PI4KB to assess regulatory effects

What are the most promising unexplored aspects of C10orf76 biology?

Several aspects of C10orf76 biology warrant further investigation:

  • Structural biology: High-resolution structures of the C10orf76-PI4KB complex would provide crucial insights into the mechanism of interaction and regulation

  • Phosphatidylinositol dynamics: Further investigation of how C10orf76 influences phosphatidylinositol transfer and metabolism beyond PI4KB interaction

  • Regulatory networks: Comprehensive mapping of C10orf76's position in larger regulatory networks involving Arf1/GBF1, ACBD3, and other Golgi trafficking regulators

  • Viral exploitation mechanisms: Detailed molecular mechanisms of how different enteroviruses exploit or bypass C10orf76-dependent pathways

What technologies are emerging as valuable for studying C10orf76 functions?

Emerging technologies with particular promise for C10orf76 research include:

  • Cryo-electron microscopy: For structural determination of the C10orf76-PI4KB complex and potentially larger multiprotein assemblies

  • Proximity labeling proteomics: BioID or APEX2-based approaches to identify the complete C10orf76 interactome in living cells

  • Live-cell PI4P sensors: Advanced fluorescent sensors to monitor PI4P dynamics in real-time during viral infection or membrane trafficking events

  • CRISPR-based screening: Genome-wide or targeted screens to identify additional factors that modify C10orf76 function

  • Single-molecule imaging: To track the dynamics of individual C10orf76-PI4KB complexes at the Golgi in living cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.