Recombinant Human UPF0694 transmembrane protein C14orf109 (C14orf109)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

ParameterDetails
Gene NameTMEM251 (previously C14orf109)
Alternative NamesUPF0694, Transmembrane Protein 251, GCAF (GNPTAB Cleavage and Activity Factor)
Chromosomal Location14q32.12 (human), 12 E (mouse)
Protein Length163 amino acids (1-163aa)
Primary StructureContains proline residues in transmembrane domains; supports mitochondrial inner membrane sorting
Transcript VariantsSix mRNA variants, with two encoding proteins (shorter and longer N-terminus)

The protein is highly conserved across species, with a GDI score of 21.351, indicating functional importance . Its sequence includes a hydrophobic transmembrane region and a C-terminal domain critical for antibody recognition .

Role in Lysosomal Trafficking

C14orf109 interacts with GNPTAB, a key enzyme in lysosomal enzyme activation. Mutations in TMEM251 have been linked to severe skeletal dysplasia, suggesting its role in bone development .

Mitochondrial Protein Sorting

The presence of proline residues in its transmembrane domains facilitates sorting to mitochondrial inner membranes, a critical determinant of mitochondrial protein localization .

Clinical Relevance

Biallelic variants in TMEM251 (e.g., c.215dupA; p.Tyr72Ter) cause autosomal recessive skeletal disorders, as observed in consanguineous families .

Antibodies

AntibodyHost/TypeImmunogenApplications
PA5-61769 Rabbit polyclonalRecombinant C14orf109 (C-terminal)WB, IHC, ICC
sc-242031 Goat polyclonalInternal peptide (I-18)WB, IF, ELISA
Control Fragment Recombinant proteinaa 128-163 (C-terminal)Blocking experiments with PA5-61769

Notes:

  • PA5-61769 shows 100% identity to mouse/rat orthologs .

  • sc-242031 detects C14orf109 in human, mouse, rat, and other species .

Secondary Reagents

For Western blotting, use donkey anti-goat IgG-HRP (e.g., sc-2020) .

Applications in Research

  1. Structural Studies: Proline-rich transmembrane domains are targets for studying mitochondrial protein import .

  2. Disease Modeling: Recombinant protein aids in studying skeletal dysplasia mechanisms .

  3. Immunoassays: Antibodies enable validation of protein expression in cell lines or tissues .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize its incorporation.
Synonyms
TMEM251; C14orf109; Transmembrane protein 251
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
TMEM251
Target Protein Sequence
MPKPPDYSELSDSLTLAVGTGRFSGPLHRAWRMMNFRQRMGWIGVGLYLLASAAAFYYVF EISETYNRLALEHIQQHPEEPLEGTTWTHSLKAQLLSLPFWVWTVIFLVPYLQMFLFLYS CTRADPKTVGYCIIPICLAVICNRHQAFVKASNQISRLQLIDT
Uniprot No.

Target Background

Database Links

HGNC: 20218

KEGG: hsa:26175

UniGene: Hs.275352

Protein Families
TMEM251 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic location and structure of C14orf109?

C14orf109, also known as TMEM251 (Transmembrane Protein 251), is located on human chromosome 14 at position 14q32.12 . Chromosome 14 contains approximately 700 genes and 106 million base pairs, making up about 3.5% of human cellular DNA . The gene encodes a transmembrane protein with a predicted molecular weight of 19/15 kDa .

The genomic context is noteworthy as chromosome 14 houses several medically significant genes, including presenilin 1 (PSEN1) associated with Alzheimer's disease and SERPINA1 linked to α1-antitrypsin deficiency . Additionally, the immunoglobulin heavy chain locus on chromosome 14 has been identified in (14;19) translocations in various B cell malignancies .

For structural analysis, researchers should employ transmembrane prediction algorithms to identify membrane-spanning domains. While the search results don't specify the exact topology, the UPF0694 classification indicates an uncharacterized protein family, suggesting limited structural information currently exists in public databases.

What detection methods are available for studying C14orf109 protein?

Multiple molecular tools are available for C14orf109 detection and manipulation:

Antibody-based detection:

Affinity-purified goat polyclonal antibodies raised against peptides from internal regions of human C14orf109 can be utilized for multiple applications :

  • Western blotting (recommended dilution 1:100-1:1000)

  • Immunofluorescence (recommended dilution 1:50-1:500)

  • Solid-phase ELISA (recommended dilution 1:30-1:3000)

These antibodies have demonstrated cross-reactivity with C14orf109 homologs in multiple species including mouse, equine, canine, bovine, porcine, and avian models .

Gene manipulation tools:

For loss-of-function studies, researchers can employ:

  • siRNA for transient knockdown in human (sc-106903) or mouse (sc-142803) cells

  • shRNA plasmids for stable knockdown in human (sc-106903-SH) or mouse (sc-142803-SH) models

  • Lentiviral particles delivering shRNA for difficult-to-transfect cells

  • CRISPR/Cas9 Double Nickase plasmids for gene knockout, offering improved specificity through paired D10A mutated Cas9 nucleases with target-specific gRNAs

When designing detection experiments, consider using positive and negative controls to validate specificity, particularly since C14orf109 is relatively uncharacterized.

What are the most effective gene knockout strategies for C14orf109?

The CRISPR/Cas9 system represents the most sophisticated approach for C14orf109 gene knockout. Specifically, the Double Nickase strategy offers significant advantages:

Double Nickase CRISPR approach:

C14orf109 Double Nickase Plasmid (h) and C14orf109 Double Nickase Plasmid (h2) employ paired plasmids, each encoding a D10A mutated Cas9 nuclease and unique target-specific guide RNAs . This system creates highly specific Cas9-mediated double nicking of the TMEM251 gene that mimics a double-strand break (DSB) .

The double nickase approach provides enhanced specificity compared to standard CRISPR/Cas9 knockout methods while maintaining high knockout efficiency . This specificity is particularly important when studying uncharacterized proteins like C14orf109 where off-target effects could confound experimental interpretation.

Experimental design considerations:

  • Validation strategy: Design PCR primers spanning the target region to confirm editing

  • Clonal selection: Isolate and characterize multiple independent clones to rule out clonal artifacts

  • Off-target analysis: Consider sequencing potential off-target sites predicted by bioinformatic tools

  • Functional validation: Confirm protein loss via Western blotting with available antibodies

  • Rescue experiments: Reintroduce wild-type C14orf109 to confirm phenotype specificity

For challenging cell types, combining CRISPR with lentiviral delivery systems may enhance editing efficiency.

How can researchers investigate the potential function of C14orf109?

Given that C14orf109 belongs to the UPF0694 family (Uncharacterized Protein Family), a multi-faceted approach is essential:

Subcellular localization:

Determine precise membrane localization using the available antibodies with markers for different cellular compartments. This provides crucial context for functional hypotheses.

Interactome analysis:

Identify binding partners through:

  • Affinity purification coupled with mass spectrometry

  • Proximity labeling (BioID/APEX) particularly useful for transmembrane proteins

  • Co-immunoprecipitation studies using available antibodies

Loss-of-function phenotyping:

Utilize the available gene manipulation tools to assess cellular phenotypes:

  • Cell growth, migration, and morphology

  • Membrane dynamics and trafficking

  • Response to cellular stressors

  • Metabolic alterations

Transcriptomics/proteomics:

Compare gene expression profiles and proteome changes between wild-type and C14orf109-deficient cells to identify affected pathways.

Comparative analysis:

Leverage information from better-characterized orthologs in model organisms, noting that the mouse ortholog is Tmem251 (D230037D09Rik) .

What is known about C14orf109 inhibitors and their research applications?

C14orf109 inhibitors constitute a specialized class of chemical compounds designed to selectively modulate the activity of the C14orf109 protein . These inhibitors offer complementary approaches to genetic manipulation:

Inhibitor characteristics:

These compounds exhibit specific chemical structures enabling selective interaction with defined binding sites on C14orf109 . They are carefully designed to ensure high specificity, minimizing unintended effects on other cellular components or proteins within the broader open reading frame family .

Mechanism of action:

C14orf109 inhibitors function by disrupting the normal functioning of the C14orf109 protein, potentially impacting cellular processes associated with its functional role . This approach allows researchers to acutely and reversibly modulate protein function, providing temporal control not achievable with genetic approaches.

Experimental applications:

  • Acute vs. chronic effects: Compare short-term inhibitor treatment with long-term genetic knockdown

  • Structure-function analysis: Test inhibitors targeting different domains

  • Temporal studies: Apply inhibitors at specific developmental or cell cycle stages

  • Combination studies: Use with genetic approaches to validate specificity

When using inhibitors, dose-response studies are critical to establish appropriate concentrations balancing efficacy and specificity.

What cellular pathways might C14orf109 participate in?

While specific pathway information is limited in the search results, informed hypotheses can be developed based on transmembrane protein biology:

Potential pathways to investigate:

  • Membrane transport processes:

    • Ion transport across cellular membranes

    • Small molecule uptake or efflux

    • Vesicular trafficking or membrane fusion events

  • Signaling pathways:

    • Receptor or co-receptor functionality

    • Scaffold for signaling complexes

    • Signal modulation across membrane compartments

  • Cellular homeostasis mechanisms:

    • Organelle function (ER, Golgi, mitochondria)

    • Stress response pathways

    • Cellular metabolism regulation

Experimental strategies:

Conduct pathway analysis following C14orf109 perturbation using:

  • Phosphoproteomic analysis to identify altered signaling cascades

  • Metabolomic profiling to detect changes in metabolic pathways

  • Transcriptomic analysis with pathway enrichment to highlight affected systems

These approaches should be performed under both normal and stress conditions to reveal context-dependent functions.

What model systems are most appropriate for studying C14orf109?

The selection of appropriate model systems should consider physiological relevance and technical feasibility:

Cell-based models:

Human cell lines offer direct relevance, while the availability of reagents for mouse Tmem251 (D230037D09Rik) provides options for comparative studies . The cross-reactivity of available antibodies with equine, canine, bovine, porcine, and avian orthologs expands potential model systems .

Selection criteria:

  • Expression profile: Choose systems with detectable endogenous expression

  • Experimental tractability: Consider transfection efficiency and growth characteristics

  • Physiological relevance: Select models reflecting the biological context of interest

  • Available tools: Ensure compatibility with available antibodies and genetic tools

Comparative approach:

Utilizing multiple model systems can provide robust validation of findings and highlight evolutionarily conserved functions versus species-specific adaptations.

How does post-translational modification affect C14orf109 function?

As a transmembrane protein, C14orf109 likely undergoes various post-translational modifications (PTMs) that regulate its function, localization, and turnover:

Potential PTMs to investigate:

  • Phosphorylation: Particularly of cytoplasmic domains, potentially regulating signaling or protein interactions

  • Glycosylation: N-linked or O-linked modifications of extracellular domains affecting stability or recognition

  • Ubiquitination: Regulating protein turnover, trafficking, or signaling functions

  • Palmitoylation/Lipid modifications: Affecting membrane association or microdomain localization

Methodological approach:

  • Mass spectrometry to identify and map modifications

  • Site-directed mutagenesis of predicted modification sites

  • Pharmacological inhibition of modifying enzymes

  • Antibodies specific to modified forms

Understanding the PTM landscape of C14orf109 may provide crucial insights into its regulation and function within cellular contexts.

What challenges exist in studying uncharacterized transmembrane proteins like C14orf109?

Investigating proteins from Uncharacterized Protein Families (UPF) presents unique challenges:

Technical challenges:

  • Expression and purification difficulties: Transmembrane proteins often require specialized conditions

  • Functional assay design: Without known activity, selecting appropriate readouts is complex

  • Antibody specificity: Validation is critical given limited prior characterization

  • Structural analysis limitations: Membrane proteins are challenging for crystallography or cryo-EM

Data interpretation challenges:

  • Distinguishing direct vs. indirect effects: Deconvoluting primary functions from secondary consequences

  • Relevance assessment: Determining physiological significance of observed phenomena

  • Linking molecular mechanisms to cellular phenotypes: Establishing causal relationships

Recommended strategies:

  • Employ complementary approaches (genetic, biochemical, computational)

  • Utilize comparative genomics to leverage evolutionary conservation

  • Develop unbiased screening approaches

  • Collaborate across disciplines for diverse methodological expertise

How can bioinformatic approaches predict C14orf109 function?

Computational methods offer valuable insights for hypothesis generation about C14orf109:

Sequence-based analysis:

  • Homology detection to identify distant functional relatives

  • Conserved domain and motif prediction

  • Secondary structure prediction and transmembrane topology mapping

  • Evolutionary conservation analysis to identify functionally constrained regions

Structure prediction:

  • De novo structure prediction using AlphaFold2 or similar tools

  • Structural comparison with characterized membrane proteins

  • Binding site and interface prediction

  • Molecular dynamics simulations to understand flexibility and potential conformational changes

Network-based approaches:

  • Co-expression analysis across tissues and conditions

  • Protein-protein interaction network integration

  • Pathway enrichment analysis of correlated genes

  • Gene neighborhood analysis in prokaryotic homologs

Integrated prediction approaches:

  • Machine learning methods combining multiple data types

  • Function prediction algorithms (GO term assignment, enzyme classification)

  • Subcellular localization prediction

These computational predictions should guide experimental design, with each prediction generating testable hypotheses about C14orf109 function.

What role might C14orf109 play in disease processes?

While specific disease associations for C14orf109 are not detailed in the search results, its genomic context provides potential directions for investigation:

Genomic context considerations:

Chromosome 14 houses several disease-associated genes, including:

  • Presenilin 1 (PSEN1) associated with Alzheimer's disease

  • SERPINA1 linked to α1-antitrypsin deficiency with liver and lung manifestations

  • Immunoglobulin heavy chain locus implicated in B cell malignancies

This genomic neighborhood suggests potential involvement in neurological disorders, immune function, or metabolic processes.

Investigative approaches:

  • Expression analysis: Compare C14orf109 levels in healthy versus disease tissues

  • Genetic association studies: Examine SNPs or copy number variations in patient cohorts

  • Functional studies: Assess how C14orf109 perturbation affects disease-relevant phenotypes

  • Animal models: Evaluate disease susceptibility in C14orf109-deficient animals

Understanding potential disease associations could provide not only mechanistic insights but also therapeutic opportunities through specifically designed inhibitors .

How does C14orf109 compare to other transmembrane proteins?

Comparative analysis with better-characterized transmembrane proteins can illuminate C14orf109's potential functions:

Comparative dimensions:

  • Structural features: Transmembrane domain organization, topology, and conserved motifs

  • Evolutionary relationships: Phylogenetic analysis with functionally characterized proteins

  • Expression patterns: Tissue distribution and subcellular localization similarities

  • Interactome overlap: Shared interaction partners suggesting functional relationships

Methodological approach:

  • Sequence alignment with diverse transmembrane protein families

  • Structural modeling and comparison with solved membrane protein structures

  • Comparative analysis of predicted functional sites

  • Ortholog function analysis across evolutionary distance

This comparative approach can place C14orf109 within the broader context of membrane protein biology and potentially identify functional analogs despite limited sequence similarity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.