Recombinant Human UPF0697 protein C8orf40 (C8orf40)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant Human UPF0697 protein C8orf40 (C8orf40) is a synthetic version of the endogenous human protein encoded by the C8orf40 gene (also known as SMIM19). It belongs to the UPF0697 family and is characterized as a single-pass transmembrane protein . The recombinant form is produced via genetic engineering in heterologous expression systems, such as E. coli, yeast, baculovirus, or mammalian cells, with engineered tags for purification and detection .

Primary Sequence and Domains

The human C8orf40 protein contains 107 amino acids (AA), with a predicted transmembrane domain spanning residues 21–100/107 . Key structural features include:

FeatureDescription
Transmembrane DomainSingle-pass α-helical structure (residues 21–100/107)
N-Terminal TagEngineered for purification (e.g., His-tag, GST-tag)
C-Terminal TagOptional, depending on expression system and stability requirements

The recombinant protein’s sequence matches the natural human variant, with modifications limited to tags and expression optimization .

Functional Insights and Pathways

While the precise biological role of C8orf40 remains under investigation, its classification within the UPF0697 family suggests involvement in membrane-associated processes. Limited evidence points to:

  • Potential interactions: Direct protein-molecule interactions detected via yeast two-hybrid, co-immunoprecipitation (co-IP), and pull-down assays .

  • Pathway associations: Participation in pathways linked to membrane integrity, signaling, or transport .

No specific enzymatic activity or ligand-binding motifs have been identified to date .

Applications in Research

Recombinant C8orf40 is utilized in molecular biology and biochemistry studies, including:

ApplicationMethodDilution/UsageReference
Western Blot (WB)Detection of C8orf40 expression1:300–5000
ELISAQuantification of protein levels50 µg vials
ImmunofluorescenceSubcellular localization studies1:50–200 (IHC-P, IHC-F, ICC)

Antibodies (e.g., polyclonal rabbit anti-C8orf40 conjugated with AbBy Fluor® 594) are compatible with multiple species, including human, mouse, and bovine .

Expression Systems and Purity

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian (HEK293) cells
Purity≥85% by SDS-PAGE (lot-specific)
Storage-20°C (lyophilized) or -80°C (long-term)

Tag and Buffer Information

Tag TypeHost SystemBuffer Composition
N-TerminalE. coli/mammalianTris-based buffer, 50% glycerol
C-TerminalOptionalTBS (pH 7.4) with 1% BSA, 50% glycerol

Genomic and Chromosomal Context

Gene IDChromosomal LocationOrthologs
C8orf408p11.21Bovine, mouse, rat

Expression Patterns

  • Tissue Distribution: Ubiquitous expression, with higher levels in liver, muscle, immune cells, and glandular tissues .

  • Developmental Stages: No significant tissue-specific expression changes observed in embryonic studies .

Interactions and Regulatory Networks

While direct interaction partners remain undefined, bioinformatics predictions suggest associations with RNA-binding proteins (e.g., SFRS1, FUS) and splicing factors in 5’/3’ UTR regions . Chromatin immunoprecipitation (ChIP) data in mice indicate widespread expression, though functional roles in transcriptional regulation are unconfirmed .

Challenges and Future Directions

Key gaps include:

  1. Functional Elucidation: Limited data on cellular roles or disease associations.

  2. Interaction Mapping: High-throughput screens required to identify binding partners.

  3. Therapeutic Potential: No reported links to pathologies, though chromosome 8 abnormalities are linked to cancers and developmental disorders .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If a specific tag type is required, please specify this during your order; we will prioritize fulfilling custom tag requests.
Synonyms
SMIM19; C8orf40; Small integral membrane protein 19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SMIM19
Target Protein Sequence
MAGGYGVMGDDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRRIMRIFSVPPTE ETLSEPNFYDTISKIRLRQQLEMYSISRKYDYQQPQNQADSVQLSLE
Uniprot No.

Target Background

Database Links

HGNC: 25166

KEGG: hsa:114926

STRING: 9606.ENSP00000390750

UniGene: Hs.655320

Protein Families
SMIM19 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is UPF0697 protein C8orf40 and what is known about its structure?

UPF0697 protein C8orf40 is a protein encoded by chromosome 8 open reading frame 40 gene. It is classified as an uncharacterized protein family (UPF) member, specifically UPF0697, suggesting its function has not been fully elucidated. The protein's amino acid sequence shares homology with bovine counterparts, consisting of 107 amino acids in its expression region . While the complete tertiary structure remains to be determined through crystallography or NMR studies, sequence analysis indicates potential membrane-associated domains based on the presence of hydrophobic regions in its homologous sequences.

What are the known synonyms and identifiers for C8orf40?

Researchers should be aware of multiple nomenclatures when searching literature and databases for this protein:

  • Chromosome 8 open reading frame 40 (C8orf40)

  • UPF0697 protein C8orf40

  • ENSG00000176209 (Ensembl identifier)

  • Located at 8p11.21 chromosomal position

  • Also referenced under identifier 25166 in some databases

What expression patterns and tissue distribution have been documented for C8orf40?

Current literature provides limited information regarding the natural expression patterns of C8orf40 across human tissues. When designing experiments to investigate its expression, researchers should consider:

  • Using RT-PCR or RNA-Seq approaches to establish baseline expression profiles across tissue panels

  • Employing immunohistochemistry with validated antibodies to confirm protein-level expression

  • Correlating expression data with potential functional significance in specific cell types or tissues

What expression systems are optimal for producing recombinant C8orf40?

Selection of an appropriate expression system depends on experimental requirements:

  • E. coli and yeast expression systems provide the highest yields and shorter production timeframes, making them suitable for structural studies or applications requiring substantial protein quantities .

  • Insect cell (baculovirus) expression is recommended when post-translational modifications may be critical to protein folding or function .

  • Mammalian cell expression offers the most authentic post-translational modifications and should be considered for functional studies where native protein conformation is essential .

When designing expression constructs, consider:

  • Codon optimization for the chosen expression system

  • Inclusion of appropriate fusion tags for detection and purification

  • Signal peptide selection if secretion is desired

What purification strategies are most effective for recombinant C8orf40?

Purification strategy should be tailored to the expression system and downstream applications:

  • Affinity Chromatography: Utilizing His-tag, GST-tag, or other fusion tags for initial capture

  • Size Exclusion Chromatography: For removing aggregates and isolating monomeric protein

  • Ion Exchange Chromatography: For further purification based on charge properties

A typical workflow might involve:

  • Cell lysis under conditions that maintain protein stability

  • Initial capture via affinity chromatography

  • Secondary purification by size exclusion or ion exchange

  • Buffer exchange to remove elution components and prepare for storage

How can researchers validate the identity and integrity of purified recombinant C8orf40?

Multiple validation approaches should be combined:

  • SDS-PAGE and Western Blotting: To confirm molecular weight and immunoreactivity

  • Mass Spectrometry: For peptide mapping and sequence confirmation

  • Circular Dichroism: To assess secondary structure elements

  • Dynamic Light Scattering: To evaluate homogeneity and aggregation state

What are the optimal storage conditions for recombinant C8orf40?

Based on established protocols for similar proteins:

  • Store at -20°C for routine storage and at -80°C for extended preservation

  • Use a storage buffer containing Tris with 50% glycerol optimized for protein stability

  • Avoid repeated freeze-thaw cycles that can compromise protein integrity

  • For working stocks, maintain aliquots at 4°C for no more than one week

How should aliquoting be performed to maintain protein stability?

To preserve protein integrity:

  • Prepare small, single-use aliquots after purification to minimize freeze-thaw cycles

  • Use sterile conditions to prevent microbial contamination

  • Flash-freeze aliquots in liquid nitrogen before transferring to -20°C or -80°C storage

  • Include cryoprotectants such as glycerol (typically at 10-50%) in storage buffers

  • Consider adding reducing agents (e.g., DTT or β-mercaptoethanol) if the protein contains cysteines

What quality control measures should be implemented throughout storage periods?

Regular quality control assessments are essential:

  • Perform periodic activity assays (if functional assays exist)

  • Monitor for degradation via SDS-PAGE before experimental use

  • Check for aggregation using dynamic light scattering or size exclusion chromatography

  • Validate correct folding status through circular dichroism or intrinsic fluorescence

What experimental approaches are suitable for investigating C8orf40 interactions with other proteins?

Multiple complementary methods can be employed:

  • Co-immunoprecipitation (Co-IP): For detecting stable protein-protein interactions

    • Optimize lysis conditions to preserve native interactions

    • Use specific antibodies against C8orf40 or potential binding partners

    • Confirm results with reciprocal Co-IP experiments

  • Yeast Two-Hybrid Screening: For identifying novel interaction partners

    • Consider both N- and C-terminal fusion constructs to minimize steric hindrance

    • Validate positive hits through secondary assays

  • Proximity Labeling Approaches (BioID or APEX):

    • Generate fusion constructs with proximity labeling enzymes

    • Perform labeling in relevant cellular contexts

    • Identify neighbors through proteomics analysis

  • Fluorescence Resonance Energy Transfer (FRET):

    • Design fluorescent protein fusions that maintain native function

    • Perform live-cell imaging to detect dynamic interactions

How can researchers investigate the subcellular localization of C8orf40?

To determine the subcellular distribution:

  • Immunofluorescence Microscopy:

    • Use validated antibodies or epitope-tagged constructs

    • Perform co-localization studies with established organelle markers

    • Consider both fixed and live-cell imaging approaches

  • Subcellular Fractionation:

    • Isolate distinct cellular compartments through differential centrifugation

    • Detect protein distribution across fractions via Western blotting

    • Verify fraction purity with compartment-specific markers

  • Proximity Labeling Combined with Proteomics:

    • Use compartment-specific biotin ligases to identify neighboring proteins

    • Infer localization from the known distribution of interaction partners

What strategies should be employed to investigate potential post-translational modifications of C8orf40?

A comprehensive approach includes:

  • Bioinformatic Prediction:

    • Analyze sequence for potential modification sites (phosphorylation, glycosylation, etc.)

    • Compare predictions across species to identify conserved modification sites

  • Mass Spectrometry Analysis:

    • Perform enrichment strategies specific to the modification of interest

    • Compare modification patterns across different cellular contexts

    • Validate findings using modification-specific antibodies

  • Mutational Analysis:

    • Generate site-specific mutants of predicted modification sites

    • Assess impact on protein function, localization, and stability

    • Compare wildtype and mutant proteins under various cellular conditions

What advanced techniques can be used to investigate the structure-function relationship of C8orf40?

For deeper structural and functional insights:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map solvent-accessible regions and conformational dynamics

    • Identify potential binding interfaces when combined with ligand studies

  • Cross-linking Mass Spectrometry (XL-MS):

    • Capture spatial relationships between protein domains

    • Identify potential interaction interfaces within protein complexes

  • Cryo-Electron Microscopy:

    • Resolve high-resolution structures, particularly for larger complexes

    • Visualize conformational states under different conditions

  • CRISPR-Cas9 Genome Editing:

    • Generate knockout or knock-in cell lines

    • Perform domain-specific modifications to assess functional contributions

    • Create reporter systems for dynamic functional studies

How should researchers approach expression profiling to understand C8orf40 regulation?

A systematic approach includes:

  • Transcriptional Regulation Analysis:

    • Perform promoter analysis and reporter assays

    • Identify transcription factor binding sites through ChIP-seq

    • Investigate epigenetic regulation through bisulfite sequencing or ATAC-seq

  • Post-transcriptional Regulation:

    • Analyze mRNA stability through actinomycin D chase experiments

    • Investigate miRNA targeting through luciferase reporter assays

    • Identify RNA-binding proteins through RNA immunoprecipitation

  • Translational and Post-translational Regulation:

    • Monitor protein half-life through cycloheximide chase assays

    • Investigate regulated degradation pathways using proteasome or lysosome inhibitors

    • Assess impact of cellular stressors on protein expression and modification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.