Recombinant Human Uroplakin-1a (UPK1A)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

Recombinant Human UPK1A is typically produced in Escherichia coli (E. coli) or mammalian expression systems. Key structural and production details include:

PropertyDetails
SourceE. coli (common host for high-yield production)
TagN-terminal His tag for purification and detection
Protein LengthFull-length (1-258 amino acids) or truncated (e.g., His116–Gly231) variants
Molecular Weight~17–29 kDa (varies by construct)
Purity>90% (verified via SDS-PAGE)
ApplicationsWestern blot (WB), immunohistochemistry (IHC), ELISA, functional assays

The protein’s structure includes four transmembrane domains, critical for forming the asymmetric unit membrane (AUM) in urothelial cells, which stabilizes bladder epithelium during distension .

Biochemical and Functional Characteristics

UPK1A participates in:

  • Membrane Stabilization: Integral to AUM formation, preventing urothelial cell rupture .

  • Signal Transduction: Modulates cell adhesion, motility, and proliferation via tetraspanin-mediated pathways .

  • Tumor Suppression: Inhibits cancer cell migration, invasion, and β-catenin nuclear translocation .

Functional assays demonstrate UPK1A’s role in epithelial differentiation and bladder physiology. For example, overexpression in gastric cancer cells (MKN45) induces G1 phase arrest and reduces metastatic potential .

Key Studies on UPK1A

Study FocusFindingsCitation
Urothelial CarcinomaUPK1A expression decreases with tumor stage (94% in pTa G2 vs. 41.5% in muscle-invasive tumors). Serves as a diagnostic marker .
Gastric AdenocarcinomaReduced UPK1A correlates with lymph node metastasis (P<0.001) and poor survival (P=0.008) .
Thyroid NeoplasmsCytoplasmic UPK1A staining observed in 10–33% of cases, often at lower intensity .
Functional RoleUPK1A antagonizes MMP7 and inhibits β-catenin signaling, suppressing tumorigenesis .

Future Directions

Current research gaps include:

  • Therapeutic Potential: Exploring UPK1A restoration in metastatic cancers.

  • Pathway Elucidation: Detailed mechanisms of UPK1A-MMP7/β-catenin interactions.

  • Multi-Omics Integration: Correlating UPK1A expression with genomic profiles in pan-cancer studies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
UPK1A; TSPAN21; Uroplakin-1a; UP1a; Tetraspanin-21; Tspan-21; Uroplakin Ia; UPIa; UPKa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
UPK1A
Target Protein Sequence
MASAAAAEAEKGSPVVVGLLVVGNIIILLSGLSLFAETIWVTADQYRVYPLMGVSGKDDV FAGAWIAIFCGFSFFMVASFGVGAALCRRRSMVLTYLVLMLIVYIFECASCITSYTHRDY MVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATP EVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAI LMWTLPVMLIAMYFYTML
Uniprot No.

Target Background

Function
Uroplakin-1a (UPK1A) is a component of the asymmetric unit membrane (AUM), a specialized biomembrane in terminally differentiated urothelial cells. It plays a crucial role in normal bladder epithelial physiology, potentially regulating the permeability of superficial umbrella cells and stabilizing the apical membrane through AUM/cytoskeletal interactions.
Gene References Into Functions
  1. Down-regulation of UPK1A suppresses proliferation and enhances apoptosis in bladder transitional cell carcinoma cells. PMID: 25701463
  2. UPK1A expression is a potential predictor of poor prognosis in colorectal cancer patients. PMID: 25197375
  3. Reduced UPK1A expression is associated with gastric adenocarcinoma. PMID: 24698999
  4. UPK1A loss is associated with esophageal squamous cell carcinoma. PMID: 20978196
  5. Uroplakin Ia is expressed in urinary bladder transitional cell carcinoma. PMID: 12036448
  6. The genomic structure of the uroplakin Ia gene and the position of a transcriptional start site have been determined. PMID: 15913809
  7. Cryo-electron microscopy shows that FimH binding to the UP Ia extracellular domain induces conformational changes in the UP receptor complex, including movement of transmembrane helices. PMID: 19577575
Database Links

HGNC: 12577

OMIM: 611557

KEGG: hsa:11045

STRING: 9606.ENSP00000222275

UniGene: Hs.159309

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
High expression restricted to ureteric urothelium (most superficial cells); low expression in prostate. Expression in normal urothelial cells is lost in culture. Some expression in tumor cell lines derived from urothelial malignancies.

Q&A

What is UPK1A and what are its primary cellular functions?

UPK1A is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. These cell-surface proteins are characterized by four hydrophobic domains and mediate signal transduction events involved in cell development, activation, growth, and motility. UPK1A is found in the asymmetrical unit membrane (AUM) where it forms complexes with other tetraspanin proteins .

Primary functions include:

  • Regulation of normal bladder epithelial physiology

  • Maintenance of membrane permeability in superficial umbrella cells

  • Stabilization of apical membranes through AUM/cytoskeletal interactions

  • Possible tumor suppression in several cancer types

How is UPK1A expression distributed across normal tissues?

Although often described as urothelium-specific, UPK1A expression extends beyond the bladder epithelium. Analysis by RT-PCR confirms UPK1A expression in:

Tissue TypeRelative ExpressionAssociation
UrotheliumHighMajor component of urothelial plaques
Ovary/OocytesModerateColocalizes with CD9 on cell surface and exosomes
Testis/SpermsModeratePresent in reproductive tissues
StomachLow-ModeratePossible role in gastric epithelium
KidneyLow-ModerateDetected in renal tissues
ProstateLow-ModeratePresent in prostatic epithelium
EpididymisLow-ModeratePresent in male reproductive tract

Expression patterns suggest UPK1A plays roles beyond bladder function, particularly in reproductive biology .

What detection methods are most reliable for UPK1A analysis in research settings?

Multiple validated methods for UPK1A detection include:

  • RT-qPCR: Highly sensitive for mRNA expression analysis with primers targeting conserved regions

  • Western Blotting: Effective using polyclonal antibodies raised against synthesized polypeptides of human UPK1A

  • Immunohistochemistry (IHC): Successful detection in paraffin-embedded tissues with specific antibodies

  • Immunofluorescence: Useful for colocalization studies with other membrane proteins like CD9

  • Immunogold EM-labeling: High resolution analysis of subcellular localization

For standardization, positive controls should include normal urothelium samples where UPK1A expression is consistently high .

How does UPK1A expression correlate with cancer progression and prognosis?

UPK1A demonstrates complex, tissue-specific expression patterns in different cancer types:

The seemingly contradictory expression patterns across cancer types suggest tissue-specific functions of UPK1A, potentially as both an oncogene and tumor suppressor depending on cellular context .

What molecular mechanisms underlie UPK1A's tumor suppressive functions?

In gastric cancer and esophageal cancer models, UPK1A appears to function as a tumor suppressor through multiple mechanisms:

  • Cell Cycle Regulation: Overexpression of UPK1A in the MKN45 gastric cancer cell line induces G1 phase arrest, inhibiting cell proliferation

  • Migration Inhibition: Elevated UPK1A expression significantly reduces cell migration capabilities

  • Invasion Suppression: UPK1A overexpression inhibits invasive potential of cancer cells

  • Metastasis Control: Evidence suggests UPK1A may inhibit down-regulation of MMP7, a matrix metalloproteinase involved in metastasis

Experimental approach: To study these mechanisms, researchers typically employ gain-of-function studies using UPK1A-overexpressing cell lines and analyze cell cycle distribution via flow cytometry, migration via wound healing assays, and invasion through Matrigel-coated transwell chambers .

What is the relationship between UPK1A and HIF-1α in cancer metabolism?

UPK1A participates in a positive feedback loop with hypoxia-inducible factor 1α (HIF-1α) that modulates cancer cell metabolism and proliferation:

  • HIF-1α directly binds to hypoxia response elements (HRE) in the UPK1A promoter region

  • This binding upregulates UPK1A expression under hypoxic conditions

  • UPK1A in turn regulates HIF-1α activity, affecting downstream glycolysis enzymes

  • This feedback loop enhances the Warburg effect (increased glucose metabolism) in cancer cells

Functional studies demonstrate that silencing UPK1A suppresses glycolysis and proliferation in hepatocellular carcinoma cells, indicating its potential role in cancer metabolism reprogramming .

Experimental approach: ChIP assays can confirm HIF-1α binding to the UPK1A promoter, while metabolic assays measuring glucose consumption, lactate production, and expression of glycolytic enzymes can assess the functional impact of this interaction .

What is the significance of UPK1A in reproductive biology?

UPK1A plays unexpected roles in fertilization and reproductive processes:

  • Localization: In oocytes, UPK1A colocalizes with CD9 on the cell surface and in multivesicular body-derived exosomes

  • Post-translational Modification: The cytoplasmic tail of UPK1A undergoes conserved fertilization-dependent, Fyn-mediated tyrosine phosphorylation

  • Exosome Association: UPK1A is present on egg exosomes in the perivitelline space and zona pellucida, partially colocalizing with CD9 and CD81, which are known to play key roles in fertilization

Electron microscopy studies confirm UPK1A association with plasma membrane, microvilli, and intraluminal vesicles of multivesicular bodies in reproductive cells .

How does the long non-coding RNA UPK1A-AS1 influence cancer progression?

UPK1A-AS1, the antisense RNA to UPK1A, demonstrates complex and sometimes contradictory roles in different cancer types:

Cancer TypeUPK1A-AS1 ExpressionFunctional EffectMolecular Mechanism
Pancreatic Ductal AdenocarcinomaIncreasedPromotes chemoresistanceEnhances NHEJ-mediated DNA repair through strengthening Ku70-Ku80 interaction
Hepatocellular CarcinomaIncreasedPromotes proliferationBinds with EZH2 to mediate nuclear translocation; sponges miR-138-5p
Esophageal Squamous Cell CarcinomaDecreasedSuppresses proliferation and migrationFunctions by sponging miR-1248

These findings reveal that UPK1A-AS1 may function as either an oncogene or tumor suppressor depending on the cellular context .

Research methodology: RNA-seq and RT-qPCR for expression analysis; luciferase reporter and RNA pull-down assays to verify RNA-RNA interactions; functional assays (proliferation, migration, invasion) following overexpression or knockdown .

What are the optimal conditions for producing functional recombinant human UPK1A?

For researchers seeking to produce recombinant UPK1A:

  • Expression Systems:

    • E. coli: Suitable for producing fragments (e.g., His117~Gly232)

    • Mammalian cells (HEK293): Preferred for full-length protein with proper folding and post-translational modifications

  • Tags and Purification:

    • Common tags: His, T7, Avi, or Fc

    • Purification typically employs Protein A/G chromatography

  • Protein Characteristics:

    • Molecular weight: Approximately 29 kDa

    • Critical regions: The amino acid region 114-173 contains important epitopes

  • Functional Verification:

    • Antibody recognition using specific antibodies like UPK1A/2924

    • Tetramerization assays to confirm proper oligomerization

How can researchers reconcile contradictory findings regarding UPK1A expression across different cancer types?

The seemingly contradictory roles of UPK1A across cancer types may be explained by:

  • Tissue context-dependency: UPK1A may interact with tissue-specific partners

  • Cancer stage-specific effects: Expression patterns may change during progression

  • Methodological differences: Variability in detection methods, antibodies, and cutoff values

  • Alternative splicing: Different isoforms may predominate in different tissues

  • Post-translational modifications: Cell type-specific modifications may alter function

Research approach: Comparative multi-omics analysis across cancer types, careful validation of antibody specificity, and clear documentation of methodological parameters are essential to resolve these contradictions .

What is the potential of UPK1A as a biomarker in cancer diagnosis and prognosis?

UPK1A shows promise as a clinical biomarker with tissue-specific applications:

Immunohistochemical scoring system:

  • Positive staining: ≥10% positive cancer cells

  • High expression: ≥50% positive cancer cells

  • Low expression: 10-50% positive cancer cells

How can UPK1A be targeted in experimental therapeutic approaches?

Emerging experimental approaches targeting UPK1A include:

  • Modulating UPK1A expression:

    • Re-expressing UPK1A in gastric and esophageal cancers where it functions as a tumor suppressor

    • Inhibiting UPK1A in HCC where it appears to promote glycolysis and proliferation

  • Targeting the HIF-1α/UPK1A feedback loop:

    • Disrupting HIF-1α binding to the UPK1A promoter to reduce expression in hypoxic tumors

    • Modulating downstream glycolytic pathways affected by this interaction

  • UPK1A-AS1 modulation:

    • Tissue-specific approaches: promoting UPK1A-AS1 expression in ESCC; inhibiting it in PDAC and HCC

    • Targeting specific miRNA interactions (miR-1248, miR-138-5p)

These approaches require careful consideration of tissue context and should be validated in preclinical models before translation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.