Recombinant Human Uroplakin-1b (UPK1B)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant UPK1B is synthesized using multiple expression systems, with purity ≥85% as verified by SDS-PAGE :

Host SystemApplicationsPuritySource
E. coliELISA, Western blot, immunogen preparation≥85%MyBioSource
Mammalian cellsStructural studies, functional assays≥85%NeoBiotechnologies
Baculovirus/yeastHigh-yield production≥85%MyBioSource

Developmental Biology

  • Upk1b knockout mice exhibit urinary tract malformations, including duplex kidneys and urothelial dysmorphogenesis, linking UPK1B to congenital anomalies (CAKUT) .

  • Loss of UPK1B increases basal cell (Krt5/Krt14) proliferation, suggesting a role in urothelial progenitor regulation .

Cancer Research

  • Diagnostic Utility:

    • UPK1B is overexpressed in 58–95% of urothelial carcinomas and present in 48% of tumor types, including ovarian Brenner tumors and epithelioid mesothelioma .

    • Low UPK1B correlates with high-grade tumors, invasiveness, and metastasis in BCa .

  • Mechanistic Insights:

    • UPK1B knockdown reduces BCa cell proliferation by 40–60% and suppresses Wnt/β-catenin pathway proteins (β-catenin, c-myc, cyclinD1) .

    • Rescue experiments confirm UPK1B regulation by β-catenin, highlighting bidirectional signaling crosstalk .

Clinical and Research Applications

Antibody Development:

  • Mouse monoclonal antibodies (e.g., Clone UPK1B/3081) enable UPK1B detection in paraffin-embedded tissues via IHC .

  • Rabbit polyclonal antibodies (NSJ Bioreagents) are validated for Western blot and ELISA .

Therapeutic Targets:

  • UPK1B’s role in membrane stability and signaling positions it as a biomarker for bladder cancer prognosis and a potential target for metastasis inhibition .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. Please indicate your preferred format when placing your order, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us and we will prioritize its development.
Synonyms
UPK1B; TSPAN2; Uroplakin-1b; UP1b; Tetraspanin-20; Tspan-20; Uroplakin Ib; UPIb
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
Full Length
Species
Homo sapiens (Human)
Target Names
UPK1B
Target Protein Sequence
AKDNSTVRCFQGLLIFGNVIIGCCGIALTAECIFFVSDQHSLYPLLEATDNDDIYGAAWI GIFVGICLFCLSVLGIVGIMKSSRKILLAYFILMFIVYAFEVASCITAATQQDFFTPNLF LKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENND ADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNRHAWGVAWFGFAIL CWTFWVLLGTMFYWSRIEY
Uniprot No.

Target Background

Function
Uroplakin-1b (UPK1B) is a component of the asymmetric unit membrane (AUM), a highly specialized biomembrane found in terminally differentiated urothelial cells. It is believed to play a crucial role in normal bladder epithelial physiology, potentially regulating membrane permeability in superficial umbrella cells or stabilizing the apical membrane through interactions with the AUM and cytoskeletal structures.
Gene References Into Functions
  1. Urine UPIb levels may be a valuable indicator for predicting the risk of recurrent urinary tract infections in patients diagnosed with their first UTI. It may also be considered a non-invasive screening test for vesicoureteral reflux. PMID: 24559587
  2. Research has established the genomic organization of the UPIb gene. PMID: 12031497
  3. Loss of uroplakin Ib expression has been linked to bladder carcinomas. PMID: 15140401
  4. Loss of uroplakin Ib expression due to CpG methylation of Sp1/NFkappaB-binding motifs within the proximal promoter has been associated with urothelial tumors. PMID: 16354592
  5. The biopsy-induced increase in the expression of UPIb and other genes encoding membrane proteins suggests a potential role for membrane structure and stability during implantation. PMID: 18355812

Show More

Hide All

Database Links

HGNC: 12578

OMIM: 602380

KEGG: hsa:7348

STRING: 9606.ENSP00000264234

UniGene: Hs.271580

Protein Families
Tetraspanin (TM4SF) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Bladder epithelium.

Q&A

What is the structural and functional role of Uroplakin-1b in normal urothelial physiology?

Uroplakin-1b (UPK1B) is a 29.6 kDa protein encoded by the UPK1B gene located at chromosome 3q13.3-q21. It belongs to the transmembrane 4 superfamily (tetraspanin family), characterized by four hydrophobic domains. UPK1B is a critical component of the asymmetric unit membrane (AUM), where it forms complexes with other uroplakins .

In normal urothelial physiology, UPK1B:

  • Forms heterodimers with Uroplakin-3 (UPK3), which then assemble into heterotetramers with UPK1a/UPK2 dimers

  • Creates structural plaques that serve as elastic stabilizers preventing bladder wall rupture during distension

  • Potentially regulates membrane permeability of superficial umbrella cells

  • Stabilizes the apical membrane through AUM/cytoskeletal interactions

  • Serves as a marker of terminal urothelial differentiation

To study UPK1B function experimentally, researchers have used UPK1B knockout models (Upk1b^RFP/RFP mice), which demonstrated that loss of UPK1B results in urothelial plaque disruption in both bladder and kidney, confirming its essential role in maintaining urothelial integrity .

How is UPK1B expression regulated at the transcriptional level?

UPK1B gene transcription is regulated through several key mechanisms:

Transcription Factors:

  • Sp1 and NFκB are critical determinants of UPK1B transcription

  • Cooperative binding of Sp1 with NFκB family members (p50, p65, c-Rel) significantly enhances UPK1B promoter activity

  • The highest levels of UPK1B promoter activity occur with combinations of Sp1, p65, and c-Rel

Epigenetic Regulation:

  • Methylation of a CpG island spanning the proximal UPK1B promoter correlates with silenced expression in transitional cell carcinoma

  • Treatment with 5-aza-2′-deoxycytidine can reactivate UPK1B expression in UPK1B-negative cell lines, confirming methylation's regulatory role

  • Specific CpG residues located within Sp1/NFκB binding motifs are particularly important; their methylation prevents transcription factor binding

Transcription Factor Binding Sites:
The table below illustrates the effect of CpG mutations and methylation on the UPK1B promoter:

Promoter VariantSequenceEffect on Transcription
Wild-type UPK1B promoterTTACTCCCCCGCCTCAGCGAGGCAGNormal activity
Mutation 1 (CpG3)TTACTCCCCTTCCTCAGCGAGGCAGReduced activity
Mutation 2 (CpG4)TTACTCCCCCGCCTCAGTTAGGCAGReduced activity
Mutation 3 (both)TTACTCCCCTTCCTCAGTTAGGCAGSeverely reduced activity
5Me-CpG3TTACTCCCC(5-Me)CGCCTCAGCGAGGCAGReduced activity
5Me-CpG4TTACTCCCCCGCCTCAG(5-Me)CGAGGCAGReduced activity
5Me-CpG3 and 5Me-CpG4TTACTCCCC(5-Me)CGCCTCAG(5-Me)CGAGGCAGSeverely reduced activity

For experimental verification of these regulatory mechanisms, researchers use reporter gene assays, electrophoretic mobility shift assays (EMSA), and chromatin immunoprecipitation (ChIP) .

What are the contradictory findings regarding UPK1B expression in bladder cancer progression?

The research literature presents seemingly contradictory findings regarding UPK1B expression in bladder cancer:

Evidence for UPK1B upregulation in bladder cancer:

  • UPK1B is significantly overexpressed in bladder cancer tissues compared to adjacent normal tissues

  • Higher UPK1B expression correlates with worse prognosis in some studies

  • UPK1B expression positively correlates with tumor stage, lymph node metastasis, and distant metastasis

  • Knockdown of UPK1B inhibits proliferation, colony formation, and invasion of bladder cancer cells

Evidence for UPK1B downregulation with cancer progression:

  • UPK1B expression decreases from non-invasive (pTa) to muscle-invasive (pT2-4) carcinomas

  • The fraction of UPK1B-positive cases decreases from 87-89% in pTaG2 tumors to 64% in muscle-invasive carcinomas

  • Loss of UPK1B expression is associated with grade and stage progression, reflecting progressive loss of normal cell structure proteins

Resolving the contradiction:
These seemingly contradictory findings may be reconciled by understanding the molecular subtyping of bladder cancer:

  • UPK1B is a marker of the "luminal" subtype of bladder cancer, representing terminal urothelial differentiation

  • Within invasive tumors, UPK1B expression may identify cancers with retained urothelial differentiation features

  • High UPK1B within muscle-invasive tumors correlates with nodal metastasis and lymphatic vessel infiltration

  • The association between UPK1B and prognosis depends on tumor stage (significant in pT4 but not pT2/pT3)

This highlights the importance of considering tumor heterogeneity and molecular subtypes when interpreting UPK1B expression data.

What methods are optimal for detecting UPK1B expression in research and diagnostic applications?

Several methodologies are available for UPK1B detection, each with specific advantages for different research applications:

1. Immunohistochemistry (IHC):

  • Most common method for diagnostic applications

  • Provides spatial information on protein expression

  • Optimal protocol: Use formalin-fixed, paraffin-embedded tissues with antigen retrieval (boiling in 10mM Citrate Buffer, pH 6.0, for 10-20 min followed by cooling)

  • Recommended antibody concentration: 2 μg/ml for mouse monoclonal anti-UPK1B antibodies

  • Evaluation: Score as negative, weak, moderate, or strong cytoplasmic/membranous staining

  • Tissue microarrays (TMAs) allow high-throughput analysis across multiple samples

2. Quantitative Real-Time PCR (qRT-PCR):

  • For mRNA expression analysis

  • Primer design is critical:

    • Forward primer: 5'-TGTTCGTTGCTTCCAGGGCCTGC-3'

    • Reverse primer: 5'-AGTAGAACATGGTACCCAGGAGAACC-3'

  • Normalize against stable reference genes (e.g., GAPDH)

  • More sensitive than IHC for detecting low expression levels

3. Western Blotting:

  • For semi-quantitative protein analysis

  • Recommended antibodies: Mouse monoclonal antibodies against recombinant fragment protein within human UPK1B aa 100-250

  • Detects the 29.6 kDa UPK1B protein

4. Cell Culture Models:

  • For functional studies

  • Established bladder cancer cell lines with varying UPK1B expression levels:

    • High expression: EJ and T-24 cells

    • Normal urothelial control: SV-HUC-1 cells

  • For knockdown experiments, validated siRNA sequences targeting UPK1B are available

The choice of method depends on research goals, with IHC preferred for clinical diagnostics and spatial expression patterns, while qRT-PCR and Western blotting provide greater quantitative precision for basic research applications.

How does UPK1B contribute to urinary tract development, and what are the consequences of its disruption?

UPK1B plays a critical role in urinary tract development, with its disruption leading to significant developmental and functional abnormalities:

Developmental Functions of UPK1B:

  • Establishes urothelial plaques in developing bladder and kidney

  • Contributes to terminal differentiation of urothelial cells

  • Maintains proper urothelial structure and permeability barrier

  • Participates in early kidney development through mechanisms that remain to be fully elucidated

Experimental Evidence from UPK1B Knockout Models:
Studies using Upk1b^RFP/RFP mice (UPK1B knockout) have revealed:

  • Bladder Abnormalities:

    • Dysplastic urothelium with disrupted urothelial plaques

    • Expansion of progenitor cell markers (Keratin 14 and Keratin 5)

    • Increased Sonic hedgehog (Shh) expression

    • Loss of terminal differentiation markers (Keratin 20 and other uroplakins)

  • Kidney Abnormalities:

    • Stratified renal urothelium with altered cellular composition

    • Progressive age-dependent hydronephrosis

    • Unilateral duplex kidneys in 16% of knockout mice

  • Functional Consequences:

    • Compromised urothelial barrier function

    • Abnormal urinary tract development

    • Potential connection to congenital anomalies of the kidney and urinary tract (CAKUT)

These findings establish UPK1B as a potential genetic target for understanding CAKUT and other urinary tract developmental disorders. For researchers studying urinary tract development, UPK1B knockout models provide valuable insights into the molecular mechanisms governing urothelial differentiation and function.

What is the diagnostic and prognostic value of UPK1B in different cancer types?

UPK1B has emerged as a valuable diagnostic and prognostic marker across multiple cancer types, with particular utility in urological malignancies:

Diagnostic Applications:

  • Urothelial Carcinoma Identification:

    • UPK1B positivity helps distinguish urothelial carcinomas from other solid tumor entities

    • Particularly useful for:

      • Cancer metastases of unknown origin

      • Distinguishing muscle-invasive urothelial carcinomas (58% UPK1B-positive) from poorly differentiated prostatic adenocarcinomas (1% UPK1B-positive)

  • Distinguishing Other Cancer Types:

    • Positive in 87% of malignant mesotheliomas vs. 6.8% of lung adenocarcinomas

    • Positive in 9-30% of biliary, pancreatic, gastric, and esophageal adenocarcinomas vs. 0.7% of colorectal adenocarcinomas

  • Molecular Subtyping:

    • Marker of "luminal" bladder cancer subtypes

    • Expression correlates with other luminal markers (UPK1A, UPK2, UPK3A, KRT20)

Prognostic Value:

The prognostic significance of UPK1B varies by cancer stage and type:

Tumor StageUPK1B Positivity RatePrognostic Association
pTaG2 low-grade87%Not significant
pTaG2 high-grade89%Not significant
pTaG388%Not significant
pT2-4 (muscle-invasive)64%Stage-dependent
pT4 specifically~41%Favorable prognosis trend (p=0.0587)

Combined Marker Approach:

  • UPK1B expression significantly correlates with GATA3 immunostaining (p<0.0001)

  • Absence of both GATA3 and UPK1B staining is significantly linked to poor survival in pT4 carcinomas (p=0.0004)

  • 11% of GATA3-negative cancers are UPK1B-positive and 8% of UPK1B-negative cancers are GATA3-positive, suggesting complementary diagnostic value

For optimal diagnostic implementation, researchers should use UPK1B as part of a panel of urothelial markers rather than in isolation, particularly when evaluating high-stage tumors or metastatic lesions.

What experimental approaches can be used to study UPK1B function in cancer biology?

Researchers investigating UPK1B in cancer biology can employ several experimental approaches:

1. Gene Expression Modulation:

Knockdown Studies:

  • Small interfering RNA (siRNA) targeting UPK1B

  • Measure effects on:

    • Proliferation (Cell Counting Kit-8 assay, colony formation assay)

    • Migration and invasion (transwell assay)

    • Signaling pathway activation (Western blot for β-catenin, c-myc, cyclinD1)

Overexpression Studies:

  • Transfection with UPK1B expression vectors

  • Compare phenotypic changes in UPK1B-negative vs. UPK1B-positive cell lines

2. Epigenetic Regulation Analysis:

Methylation Studies:

  • Bisulfite sequencing of UPK1B promoter region

  • Treatment with 5-aza-2′-deoxycytidine to reverse methylation

  • Promoter-reporter assays with methylated vs. unmethylated constructs

Transcription Factor Studies:

  • Electrophoretic mobility shift assays (EMSA) to assess binding of Sp1 and NFκB

  • Chromatin immunoprecipitation (ChIP) to detect in vivo binding

  • Cotransfection experiments with expression vectors for Sp1, p50, p65, and c-Rel

3. Signaling Pathway Analysis:

β-catenin Pathway:

  • Western blot analysis of β-catenin, c-myc, and cyclinD1 expression

  • TOPflash/FOPflash reporter assays for β-catenin activity

  • Co-immunoprecipitation to detect protein interactions

4. In Vivo Models:

Xenograft Models:

  • Inject UPK1B-knockdown or UPK1B-overexpressing cells into immunodeficient mice

  • Monitor tumor growth, invasion, and metastasis

Genetic Mouse Models:

  • Upk1b^RFP/RFP knockout mice

  • Tissue-specific conditional knockouts

  • Analysis of urothelial differentiation markers (Keratin 5, Keratin 14, Keratin 20)

5. Clinical Correlation Studies:

Tissue Microarray Analysis:

  • IHC staining of large patient cohorts

  • Correlation with clinicopathological parameters

  • Survival analysis based on UPK1B expression levels

When designing experiments, researchers should consider the contradictory findings regarding UPK1B in different cancer contexts and include appropriate controls based on cancer subtype and stage.

How does UPK1B interact with other uroplakins to form functional complexes in the urothelium?

UPK1B participates in a sophisticated molecular assembly process with other uroplakins to form functional complexes essential for urothelial integrity:

1. Uroplakin Heterodimer Formation:

  • UPK1B preferentially pairs with UPK3 (UPK3A or UPK3B) to form heterodimers

  • This occurs within the endoplasmic reticulum during protein synthesis

  • The complementary interaction involves specific transmembrane domains and extracellular loops

  • UPK1A similarly pairs with UPK2 to form separate heterodimers

2. Heterotetramer Assembly:

  • UPK1B/UPK3 heterodimers combine with UPK1A/UPK2 heterodimers to form heterotetramers

  • This assembly occurs during transport through the Golgi apparatus

  • The tetraspanin domains of UPK1B play a critical role in mediating these interactions

  • Proper glycosylation is essential for correct assembly

3. Plaque Formation:

  • Multiple heterotetramers assemble into crystalline arrays called urothelial plaques

  • These plaques are incorporated into the apical plasma membrane of superficial umbrella cells

  • They form the asymmetric unit membrane (AUM), a specialized biomembrane structure

  • Electron microscopy reveals a characteristic rigid appearance with a thickened outer leaflet

4. Functional Consequences of Disruption:
When UPK1B is absent or dysfunction occurs:

  • Heterotetramer formation is compromised

  • Plaque assembly is disrupted

  • Umbrella cells fail to properly differentiate

  • The urothelial permeability barrier becomes compromised

  • Mechanical stability of the bladder epithelium is reduced

Experimental Approaches to Study Complex Formation:

  • Co-immunoprecipitation to detect protein-protein interactions

  • Fluorescence resonance energy transfer (FRET) to analyze proximity

  • Sucrose gradient centrifugation to isolate urothelial plaques

  • Freeze-fracture electron microscopy to visualize plaque architecture

  • Expression of tagged uroplakins to track assembly and trafficking

Understanding these interactions is critical for interpreting the phenotypic consequences of UPK1B disruption in both developmental disorders and malignancies of the urinary tract.

What are the technical challenges in producing and validating recombinant human UPK1B for research applications?

Producing and validating recombinant human UPK1B presents several technical challenges that researchers must address:

1. Expression System Selection:

  • Mammalian Expression Systems: Preferred for proper folding and post-translational modifications

    • HEK293 or CHO cells typically yield better results than bacterial systems

    • Co-expression with UPK3 may be necessary for proper folding

  • Bacterial Systems: Often result in inclusion bodies requiring refolding

    • Expression of fragments (e.g., aa 100-250) rather than full-length protein

    • Fusion tags (MBP, GST, SUMO) can improve solubility

2. Protein Structure Challenges:

  • Four transmembrane domains make UPK1B inherently difficult to express

  • Hydrophobic regions tend to aggregate during purification

  • Native conformation depends on interactions with other uroplakins

  • Detergent selection is critical for maintaining structure and function

3. Validation Approaches:

  • Structural Validation:

    • Circular dichroism to confirm secondary structure

    • Mass spectrometry for molecular weight confirmation

    • Dynamic light scattering to assess aggregation state

  • Functional Validation:

    • Binding assays with UPK3 partners

    • Incorporation into membrane-like environments (liposomes, nanodiscs)

    • Assessment of epitope accessibility using validated antibodies

4. Antibody Validation Criteria:
When validating antibodies against recombinant UPK1B:

  • Confirm specificity using Western blot against recombinant protein and tissue lysates

  • Verify expected staining pattern in known UPK1B-positive tissues (urothelium)

  • Test in UPK1B-knockout tissues as negative controls

  • Validate across multiple applications (IHC, Western blot, immunofluorescence)

5. Quality Control Standards:

  • Endotoxin testing (<1.0 EU/μg protein)

  • Purity assessment (>95% by SDS-PAGE)

  • Stability testing under various storage conditions

  • Lot-to-lot consistency in immunoreactivity and functional assays

Researchers can mitigate these challenges by expressing functional domains rather than full-length protein or by using co-expression systems that recapitulate the natural assembly process of uroplakin complexes.

How can UPK1B expression patterns be interpreted in the context of molecular subtyping of bladder cancer?

UPK1B expression has emerged as a key component in the molecular classification of bladder cancer, providing important diagnostic and prognostic information when interpreted within subtyping frameworks:

1. Molecular Subtypes of Bladder Cancer:

Bladder cancers can be classified into major molecular subtypes:

  • Luminal: Characterized by urothelial differentiation markers

  • Basal: Expressing more stem/basal cell markers

  • Other subtypes: Including p53-like, neuronal, etc.

2. UPK1B as a Luminal Marker:

UPK1B is a defining component of the luminal subtype:

  • Expressed together with other terminal urothelial differentiation markers (UPK1A, UPK2, UPK3A, KRT20)

  • Associated with PPARG activation and FGFR3 mutations

  • Typically correlates with papillary morphology in non-muscle invasive disease

  • Often retained in well-differentiated invasive cancers

3. Interpretation of UPK1B Expression Changes:

Expression PatternMolecular InterpretationClinical Correlation
High UPK1B in non-invasive tumorsNormal differentiation programBetter prognosis in early-stage disease
Loss of UPK1B in invasive tumorsDedifferentiation, EMTAssociated with progression
High UPK1B within muscle-invasive tumorsLuminal subtype of MIBCHigher rates of lymphatic invasion
Absence of UPK1B and GATA3 in pT4 tumorsComplete loss of urothelial identityPoor survival (p=0.0004)

4. Research Applications of Subtyping:

  • Therapeutic Implications:

    • Luminal (UPK1B-positive) tumors may respond differently to chemotherapy

    • Potential for targeting differentiation pathways

    • Association with specific genomic alterations (FGFR3, PIK3CA)

  • Experimental Design Considerations:

    • Cell line selection should consider UPK1B status in relation to molecular subtype

    • Patient cohorts should be stratified by subtype when evaluating UPK1B associations

    • Combined markers (UPK1B with GATA3, FOXA1, etc.) provide more robust classification

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.