Recombinant Human Urotensin-2 receptor (UTS2R)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

The Recombinant Human Urotensin-2 Receptor (UTS2R), also known as GPR14, is a class A rhodopsin-family GPCR encoded by the UTS2R gene (UniProt ID: Q9UKP6). It contains 389 amino acids with seven transmembrane domains and binds endogenous ligands urotensin II (UII) and urotensin II-related peptide (URP) to mediate vasoconstriction, stress responses, and cellular proliferation .

PropertyDetail
Gene NameUTS2R
AliasesGPR14, SENR
OrganismHomo sapiens (Human)
Protein Length389 amino acids
Transmembrane Domains7
Endogenous AgonistsUrotensin II, Urotensin II-related peptide

Signaling Mechanisms

UTS2R primarily activates Gαq/11 proteins, triggering phospholipase C (PLC)-mediated calcium release and protein kinase C (PKC) activation . Secondary pathways include ERK1/2 phosphorylation and EGFR transactivation, promoting cell proliferation and migration in cancers .

In Vitro Studies

  • Ligand Binding Assays: Recombinant UTS2R is used to study peptide analogs like [Orn⁸]hU-II and antagonists such as SB-710411 .

  • Desensitization Profiling: Irreversible UII binding complicates receptor internalization studies, as observed in HEK293 and SJCRH30 cell models .

Disease Modeling

  • Cancer: UTS2R overexpression in glioblastoma (GBM) correlates with tumor aggressiveness and poor prognosis . In lung and colorectal cancers, UII-UTS2R signaling enhances migration and proliferation .

  • Metabolic Disorders: SNPs in UTS2R (e.g., -11640A/-8515C) are linked to insulin resistance and skeletal muscle fat accumulation .

Therapeutic Targets

  • Cardiovascular Diseases: UTS2R antagonists like palosuran improve insulin sensitivity in diabetic models .

  • Oncology: Radiolabeled UII analogs (e.g., ¹¹¹In-DOTA-hUII) are being tested for tumor targeting, though current tumor/muscle ratios remain suboptimal .

Genetic Mutations

  • R148H Mutation: Impairs PKC activation while retaining partial ERK1/2 signaling .

  • Promoter Polymorphisms: Alter transcriptional activity, influencing fatty acid metabolism and diabetes risk .

Key Research Findings

Study FocusKey OutcomeSource
Glioblastoma PrognosisHigh UTS2R expression reduces survival (median: 224 days)
Fatty Acid MetabolismUTS2R SNPs regulate Δ9-desaturase activity in muscle
Radioligand Development¹¹¹In-DOTA-hUII shows renal retention in murine models

Future Directions

  • Drug Development: Optimizing UT antagonists for metabolic and cardiovascular therapies.

  • Imaging Probes: Enhancing tumor specificity of radiolabeled UII analogs for diagnostic use .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
UTS2R; GPR14; Urotensin-2 receptor; UR-2-R; G-protein coupled receptor 14; Urotensin II receptor; UR-II-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS SCSPQPTDSLVLAPAAPARPAPEGPRAPA
Uniprot No.

Target Background

Function
High affinity receptor for urotensin-2 and urotensin-2B. The receptor's activity is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. Ligand-induced activation of the chemokine receptor CXCR4 and the urotensin 2 receptor UTS2R triggers a significant reduction in autophagosome biogenesis. PMID: 27715446
  2. The urotensin-II receptor plays a role in vasoconstriction and the development of digestive tract cancers. PMID: 27338741
  3. UII/GPR14 signaling is involved in DSS-induced colonic inflammation, and its inhibition may serve as a potential therapeutic target, potentially related to the NF-kappaB signaling pathway. PMID: 27600191
  4. UTII-R expression on biopsies has been associated with Gleason upgrading and pathology upstaging in prostate cancer patients. PMID: 26381851
  5. Urotensin II can induce proliferation of BEL-7402 cells via the urotensin receptor mediated PKC/ERK/p38 MAPK signaling pathways. PMID: 25514221
  6. Reports indicate an interaction of urantide with the urotensin II receptor. PMID: 24357333
  7. UTR protein and mRNA levels were elevated in colon cancer cell lines and in colon adenoma and adenocarcinoma. UTR appears to be involved in the regulation of colon cancer cell invasion and motility. PMID: 24372535
  8. High UTR expression is an independent prognostic factor associated with a favorable prognosis for non-muscle invasive bladder transitional cancer. PMID: 24893613
  9. Family-based analysis of association between blood pressure, glomerular filtration, and genes of the urotensin-II pathway (urotensin-II, urotensin-II related peptide, urotensin-II receptor) saturated with 28 tagging single nucleotide polymorphisms. PMID: 24391740
  10. Data suggest that UTS2R in aortic endothelium is involved in the development of diabetes-associated atherosclerosis. Diabetes-associated plaque development is attenuated by urotensin II/UTS2R antagonism in vitro. PMID: 23344731
  11. Presence of functional nuclear UT in various rat and monkey tissues, as well as in human cell lines. PMID: 22245063
  12. The urotensin II receptor predicts the clinical outcome of prostate cancer patients and is involved in regulating the motility of prostate adenocarcinoma cells. PMID: 21080343
  13. hUII may deteriorate monocrotaline-induced cardiac hypertrophy primarily through vasoconstriction of the pulmonary artery and partly through suppression of ANP secretion. PMID: 20870804
  14. This study demonstrates that the UT receptor is expressed on the endothelium of HCC. The U-II/UT receptor system is involved in HCC function and involves the endothelium and NO pathway. PMID: 19788716
  15. An increased sensitivity to U-II in preeclampsia might be achieved through upregulation of placental U-II receptors. PMID: 20479331
  16. These findings suggest that the intrahepatic UII/UT system plays a significant pathophysiological role in cirrhosis and portal hypertension. PMID: 20428787
  17. The urotensin II receptor (U2R) is up-regulated by interferon-gamma. PMID: 14753294
  18. Monocytes and macrophages were the primary producers of GPR14 mRNA, with relatively low expression in foam cells, lymphocytes, and platelets. PMID: 15306183
  19. Subjects with the S89N amino acid substitution exhibit increased insulin resistance and are therefore more susceptible to developing type 2 diabetes mellitus. PMID: 15476949
  20. While both mRNA for the UT receptor and U-II binding were still present, ANG II receptors were also present, as demonstrated by ANG II-induced calcium mobilization. PMID: 15752584
  21. Diagnostic reagent kits employing human rhabdomyosarcoma cells expressing UTS2R were compared. PMID: 17537987
  22. GPR14 is a candidate for the guanylate cyclase independent receptor for guanylin peptides. PMID: 17595527
  23. Cloning and functional characterization of the human UT receptor gene promoter revealed the presence of NF-kappaB-binding sites involved in UT receptor gene expression. PMID: 17617581
  24. Data indicate that both urotensin II and the urotensin II receptor are expressed in adrenal tumors and attached non-neoplastic adrenal tissues, suggesting potential roles for UII and UT-R in tumor growth and/or secretion. PMID: 17686550
  25. Results describe the differential expression of urotensin II receptors in cardiovascular tissues from rats and humans, suggesting that it may account for the diverse vascular actions reported for urotensin-II. PMID: 17905478
  26. To understand the molecular interactions of hU-II and certain antagonists with the hUT-II receptor, a model of the hUT-II receptor in an active conformation with all its connecting loops was constructed by homology modeling. PMID: 18409194
  27. Results describe the solution structure of urotensin-II receptor extracellular loop III and characterize its interaction with urotensin-II. PMID: 18423797
  28. Urotensin II receptor activation in vivo enhanced the adrenocortical expression of immunoreactive aldosterone synthase. PMID: 19001524
  29. Demonstrates a significant role for UTS2R in the pathogenesis of atherosclerosis. The use of UTS2R receptor antagonists may offer a beneficial tool in managing this debilitating disease process. PMID: 19111831

Show More

Hide All

Database Links

HGNC: 4468

OMIM: 600896

KEGG: hsa:2837

STRING: 9606.ENSP00000323516

UniGene: Hs.192720

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Most abundant expression in the heart and pancreas.

Q&A

What is the basic structure and classification of human UTS2R?

The human urotensin-2 receptor (UTS2R), also known as GPR14, is a class A rhodopsin family G protein-coupled receptor (GPCR) consisting of 386 amino acids. The receptor has gained significant attention in cardiovascular research after it was discovered that its activation by urotensin II produces one of the most potent vasoconstriction effects documented in physiological systems. The receptor's structure includes the characteristic seven-transmembrane domain organization typical of GPCRs, with specific binding domains for its endogenous ligands .

For experimental characterization, most researchers employ techniques such as site-directed mutagenesis to identify critical amino acid residues involved in ligand binding. Computational modeling approaches like homology modeling based on crystallized GPCRs can provide preliminary structural insights before experimental validation.

What are the known endogenous ligands for UTS2R and their relative binding affinities?

Two primary endogenous agonists for UTS2R have been identified: urotensin II (U-II) and urotensin II-related peptide (URP). U-II was originally isolated from goby urophysis in the 1960s as a vasoactive peptide with significant roles in cardiovascular homeostasis . The human isoform was later identified by Ames et al. in 1999, which catalyzed research into U-II/UTS2R interactions .

Comparative binding studies show that both peptides exhibit high-affinity binding to UTS2R, with U-II typically demonstrating stronger receptor activation. When designing experiments to study differential activation, researchers should consider using concentration-response analyses, as demonstrated in studies where the half-maximal effective concentration (pEC50) values provide quantitative measures of binding affinity and receptor activation potency .

What are the optimal conditions for expressing and purifying recombinant human UTS2R for structural studies?

For successful expression and purification of recombinant human UTS2R, researchers typically employ either E. coli, yeast, baculovirus, or mammalian cell expression systems depending on the experimental requirements. Each system offers different advantages:

Expression SystemAdvantagesLimitationsBest Application
E. coliHigh yield, low cost, rapid expressionLimited post-translational modificationsProtein fragments, binding domains
YeastModerate yield, some post-translational modificationsGlycosylation patterns differ from mammalsFull-length protein for functional studies
BaculovirusHigh yield, mammalian-like modificationsMore complex methodologyStructural studies requiring native-like protein
Mammalian cellsNative-like post-translational modificationsLower yield, higher costInteraction studies, signaling experiments

For optimal purification results, recombinant UTS2R should achieve ≥85% purity as determined by SDS-PAGE . The protein is typically produced with N-terminal tags and potentially C-terminal tags to facilitate purification and detection. Tag selection should be guided by protein-tag stability considerations, and researchers should empirically determine the optimal tag for their specific experimental goals .

How can I design effective binding assays to evaluate novel UTS2R ligands?

Designing effective binding assays for novel UTS2R ligands requires careful consideration of assay format, detection method, and controls. Competitive binding assays represent the gold standard for direct interaction studies. As demonstrated in remdesivir-UTS2R interaction studies, researchers should:

  • Establish baseline binding parameters using known ligands such as biotin-labeled urotensin II peptide (biotin-UT2)

  • Optimize membrane fraction preparation from cells expressing UTS2R

  • Select appropriate binding detection methods (radioligand, fluorescence, or biotin-based pulldown)

  • Incorporate proper controls including non-specific binding determination

For pulldown assays specifically, magnetic beads with hydrophobic coating have shown maximum efficacy with low non-specific binding . When testing novel compounds, include both positive controls (known UTS2R ligands) and negative controls (structurally similar compounds without UTS2R activity) to ensure assay validity and specificity.

What strategies are most effective for identifying the binding pocket and key interaction residues between UTS2R and novel ligands?

For identifying binding pockets and key interaction residues between UTS2R and novel ligands, researchers should employ a multi-faceted approach combining computational and experimental techniques:

  • Computational modeling: Begin with molecular docking studies to generate hypotheses about potential binding modes and interaction residues. This approach successfully identified potential binding sites for remdesivir on UTS2R .

  • Site-directed mutagenesis: Systematically mutate predicted contact residues based on computational models. For instance, mutation of residue D130³·³² in UTS2R significantly altered remdesivir binding, validating its role in the interaction .

  • Structure-activity relationship (SAR) studies: Synthesize ligand derivatives with systematic modifications to map the pharmacophore requirements. Previous SAR studies revealed that U-II adopts a compact conformation with a hydrophobic pocket, informing ligand design strategies .

  • Biophysical validation: Confirm binding interactions using techniques such as NMR spectroscopy, which has previously elucidated structural features of U-II .

The integration of these approaches provides robust evidence for binding mechanisms and identifies residues critical for selective targeting.

How do I distinguish between different G-protein coupling pathways activated by UTS2R in response to various ligands?

Distinguishing between different G-protein coupling pathways activated by UTS2R requires systematic analysis of downstream signaling cascades. UTS2R is known to primarily couple to Gq proteins, activating phosphatidylinositol-calcium second messenger systems, but can potentially signal through multiple G-protein subtypes depending on the ligand and cellular context .

To effectively characterize these pathways:

  • Employ chimeric Gα subunit proteins for initial screening to efficiently detect receptor activation regardless of the G-protein subtype involved. This approach was successfully used to identify remdesivir as a selective UTS2R activator .

  • Measure specific second messengers associated with different G-protein pathways:

    • Gq coupling: calcium mobilization, IP3 accumulation

    • Gs coupling: cAMP production

    • Gi coupling: inhibition of forskolin-stimulated cAMP

    • G12/13 coupling: RhoA activation

  • Use pathway-selective inhibitors to confirm the involvement of specific G-proteins (e.g., YM-254890 for Gq inhibition).

  • Employ BRET/FRET-based assays to directly measure receptor-G-protein coupling in real-time.

When comparing biased signaling between different ligands, normalize responses to a reference ligand (typically the endogenous urotensin II) to calculate bias factors.

Therapeutic Relevance and Disease Models

Post-translational modifications (PTMs) of UTS2R can significantly impact ligand binding affinity, receptor trafficking, and signaling efficiency, potentially contributing to altered receptor function in disease states. Though comprehensive characterization of UTS2R PTMs remains incomplete, research should consider:

  • Glycosylation: N-linked glycosylation sites can affect receptor folding, membrane expression, and ligand binding. When expressing recombinant UTS2R, the choice of expression system significantly impacts glycosylation patterns, with mammalian cell systems providing the most physiologically relevant modifications .

  • Phosphorylation: GPCR phosphorylation by various kinases (GRKs, PKA, PKC) regulates desensitization and internalization. Researchers should examine phosphorylation states in disease models, particularly in contexts of chronic UTS2R stimulation.

  • Palmitoylation: This lipid modification can affect receptor localization and coupling efficiency. Site-directed mutagenesis of putative palmitoylation sites can help determine their functional significance.

  • Ubiquitination: This modification regulates receptor degradation and recycling pathways, potentially altered in disease states.

For experimental investigation of PTMs in disease contexts, researchers should combine mass spectrometry-based proteomic approaches with site-specific mutants and inhibitors of specific modification pathways.

What are the latest findings regarding UTS2R activation by non-canonical ligands such as remdesivir?

Recent research has revealed the unexpected finding that remdesivir, an antiviral drug developed for treating RNA virus infections, can directly activate the urotensin-II receptor (UTS2R). This novel interaction was discovered through systematic screening using chimeric Gα subunit proteins to detect receptor activation .

Key findings regarding remdesivir-UTS2R interaction include:

  • Remdesivir demonstrates selective activation of UTS2R with a half-maximal effective concentration (pEC50) of 4.89 ± 0.03 (EC50 = 13 ± 0.9 μM) .

  • Mechanistic studies revealed that both the McGuigan prodrug moiety and nucleoside base of remdesivir are required for UTS2R activation. Other nucleoside analogues and McGuigan-class prodrugs like sofosbuvir did not activate UTS2R, suggesting structural specificity .

  • Competitive binding assays and biochemical pulldown experiments confirmed direct interaction between remdesivir and UTS2R, with remdesivir significantly impairing biotin-UT2-mediated UTS2R pulldown .

  • Molecular docking and mutagenesis studies identified specific binding residues, including D130³·³², which is located near the nucleobase moiety of remdesivir .

This discovery has important implications for understanding potential cardiovascular side effects of remdesivir and opens new avenues for developing selective UTS2R ligands based on nucleoside analog scaffolds.

How can CRISPR-Cas9 gene editing be optimized for studying UTS2R function in cellular and animal models?

CRISPR-Cas9 gene editing offers powerful approaches for investigating UTS2R function through precise genetic manipulation. For optimal application in UTS2R research:

  • Guide RNA (gRNA) design:

    • Target conserved functional domains of UTS2R, such as ligand-binding regions or G-protein coupling interfaces

    • Design multiple gRNAs (3-4) targeting different exons to increase editing efficiency

    • Use algorithms that minimize off-target effects while maximizing on-target efficiency

    • For studying specific UTS2R variants or polymorphisms, employ base editing or prime editing techniques

  • Delivery optimization:

    • For cell lines: Lipofection or electroporation of ribonucleoprotein complexes typically yields higher efficiency than plasmid-based approaches

    • For primary cells: Consider lentiviral delivery systems with appropriate promoters

    • For animal models: Adeno-associated virus (AAV) delivery with tissue-specific promoters can achieve targeted UTS2R modification

  • Validation strategies:

    • Sequencing: Confirm edits at genomic DNA level

    • Western blotting: Verify changes in protein expression

    • Functional assays: Assess receptor activity using calcium mobilization or binding assays

    • Off-target analysis: Employ whole-genome sequencing or targeted sequencing of predicted off-target sites

  • Model development approaches:

    • Complete knockout: To study loss-of-function phenotypes

    • Point mutations: To investigate specific residues involved in ligand binding or signaling

    • Knock-in reporters: To track receptor expression and trafficking

    • Conditional systems: To control temporal aspects of UTS2R modification

When designing CRISPR experiments, researchers should carefully consider the tissue-specific expression patterns of UTS2R in cardiovascular, renal, and central nervous systems to select appropriate cellular models.

What are the most significant unresolved questions in UTS2R research that warrant future investigation?

Despite considerable advances in understanding UTS2R biology, several critical questions remain unresolved and represent promising areas for future research:

  • Structural biology: While computational models provide insights, a high-resolution crystal or cryo-EM structure of UTS2R bound to agonists and antagonists would significantly advance structure-based drug design efforts.

  • Signaling diversity: The extent of biased signaling through different G-protein and β-arrestin pathways remains incompletely characterized, particularly how different ligands may selectively activate specific pathways.

  • Physiological role clarification: The precise physiological functions of UTS2R in different tissues require further elucidation, especially regarding its roles in stress responses and REM sleep regulation .

  • Therapeutic targeting specificity: Developing highly selective UTS2R modulators that can distinguish between beneficial and pathological receptor activation remains challenging.

  • Cross-talk with other systems: The interaction between UTS2R signaling and other regulatory systems (renin-angiotensin, endothelin, sympathetic nervous system) in both physiological and pathological contexts warrants deeper investigation.

Addressing these questions will require interdisciplinary approaches combining structural biology, pharmacology, physiology, and translational medicine to fully unlock the therapeutic potential of targeting the urotensin system.

What are the best practices for long-term storage and handling of recombinant UTS2R to maintain protein stability and functionality?

Maintaining the stability and functionality of recombinant UTS2R is critical for experimental reproducibility. Based on established protocols, researchers should implement the following best practices:

  • Storage temperature conditions:

    • For long-term storage: Store at -80°C or -20°C in aliquots to minimize freeze-thaw cycles

    • For working preparations: Store aliquots at 4°C for up to one week

    • Avoid repeated freezing and thawing, which significantly reduces protein activity

  • Formulation considerations:

    • Buffer composition: Typically phosphate or Tris buffers with physiological pH (7.2-7.4)

    • Stabilizing additives: Consider adding glycerol (10-20%), reducing agents, and protease inhibitors

    • For lyophilized preparations: Reconstitute only the amount needed for immediate use

  • Quality control measures:

    • Regularly assess protein purity (≥85% as determined by SDS-PAGE)

    • Verify receptor functionality using binding assays before critical experiments

    • Document lot-specific characteristics and activity levels

  • Special handling notes:

    • If small volumes become entrapped in the seal of the product vial during shipment or storage, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container's cap

    • For preparations requiring sterility, sterile filtration options are available upon request

    • Low endotoxin preparations should be considered for cell-based assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.