Recombinant Human V-set and transmembrane domain-containing protein 2B (VSTM2B)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

VSTM2B is a 285-amino acid single-pass type I membrane protein containing:

  • An extracellular Ig-like V-type domain (29–263 aa)

  • 21-amino acid transmembrane domain

  • Short cytoplasmic region (1 aa)

Immunomodulatory Activity

  • Inhibits IFN-γ secretion (ED₅₀: 1–6 μg/mL) and IL-2 production in anti-CD3-stimulated human peripheral blood mononuclear cells .

  • Suppresses T cell proliferation in vitro .

Neurological Associations

  • Preoperative cerebrospinal fluid (CSF) levels correlate with postoperative delirium (POD) severity:

    • Day 1: r = 0.869, p = 0.005

    • Day 2: r = 0.928, p = 0.008

  • Reduced levels observed in:

    • Genetic frontotemporal dementia (fold change: 0.49 vs. controls)

    • Neuropathic pain models

Experimental Use Cases

ApplicationProtocol DetailsSource
T cell activation assays1–6 μg/mL dosage in anti-CD3-stimulated PBMCs
Biomarker studiesQuantified via LC-MS/PRM in CSF
Protein interactionELISA, Western blot

Postoperative Delirium (POD) Biomarker

Protein Level in CSFPOD Patients vs. Controls (Fold Change)p-value
VSTM2B0.5580.032
Coagulation Factor V0.7500.018

Lower preoperative VSTM2B levels predict higher MDAS scores post-surgery .

Cancer Genomics

  • Somatic mutations reported in:

    • Lung adenocarcinoma: Missense variants (e.g., A6NLU5 p.Val202Met)

    • Colorectal cancer: Frameshift deletions

Evolutionary and Genomic Context

  • Gene location: Chromosome 19q12 (GRCh38: 19:29,525,418–29,564,551)

  • Ortholog conservation:

    • 86% aa identity with mouse VSTM2B

    • 85% aa identity with rat VSTM2B

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Specify your required tag type in advance to prioritize its inclusion.
Synonyms
VSTM2B; V-set and transmembrane domain-containing protein 2B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-285
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
VSTM2B
Target Protein Sequence
AFTEVPKDVTVREGDDIEMPCAFRASGATSYSLEIQWWYLKEPPRELLHELALSVPGARSKVTNKDATKISTVRVQGNDISHRLRLSAVRLQDEGVYECRVSDYSDDDTQEHKAQAMLRVLSRFAPPNMQAAEAVSHIQSSGPRRHGPASAANANNAGAASRTTSEPGRGDKSPPPGSPPAAIDPAVPEAAAASAAHTPTTTVAAAAAASSASPPSGQAVLLRQRHGSGTGRSYTTDPLLSLLLLALHKFLRLLLGH
Uniprot No.

Target Background

Gene References Into Functions
  1. Observational study of gene-disease association. (HuGE Navigator) PMID: 19240061
Database Links

HGNC: 33595

KEGG: hsa:342865

UniGene: Hs.451618

Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is VSTM2B and which protein family does it belong to?

VSTM2B (V-set and transmembrane domain-containing protein 2B) is a membrane protein belonging to the VSTM family, which is part of the larger immunoglobulin (Ig) superfamily of transmembrane proteins. The VSTM family comprises eight identified members: VSTM1v1, VSTM1v2, VSTM2a, VSTM2b, VSTM2L, TIGIT (VSTM3, VSIG9), VSTM4, and VSTM5 . Most VSTM proteins are type I transmembrane molecules characterized by an extracellular IgV-like domain and typically contain one or more cytoplasmic ITIM (immunoreceptor tyrosine-based inhibitory motif) motifs . As part of the B7-like group of proteins, VSTM family members play important immunomodulatory roles and are increasingly recognized as potential targets for novel immunotherapies .

What is the structural composition of VSTM2B?

VSTM2B is a membrane protein with a defined domain architecture consisting of:

  • A 235 amino acid (aa) extracellular domain containing an Ig-like V-type domain

  • A 21 aa transmembrane domain

  • A minimal cytoplasmic domain comprising just one amino acid

The extracellular domain of human VSTM2B shares 45% amino acid identity with human VSTM2A, indicating some structural similarities while maintaining distinct functional properties . Notably, the mature extracellular domain of human VSTM2B demonstrates high evolutionary conservation, sharing 86% and 85% amino acid sequence identity with mouse and rat homologs, respectively . This high degree of conservation suggests important functional roles that have been preserved throughout mammalian evolution.

What are the known immunological functions of VSTM2B?

VSTM2B has been demonstrated to function as an immunosuppressive molecule, specifically inhibiting human T cell activation through multiple mechanisms:

  • Inhibition of anti-CD3 antibody-induced IFN-gamma production in human peripheral blood mononuclear cells (PBMCs) with an ED50 of 1.5-7.5 μg/mL

  • Suppression of IL-2 secretion by T cells

  • Inhibition of T cell proliferation

These findings position VSTM2B as a negative regulator of T cell-mediated immune responses, similar to other immune checkpoint molecules. While the specific binding partners and downstream signaling pathways remain to be fully elucidated, the immunosuppressive properties of VSTM2B suggest potential relevance in contexts of autoimmunity, cancer immunology, and transplantation medicine.

How does VSTM2B compare to other members of the VSTM family?

The VSTM family contains several members with demonstrated immunomodulatory functions. TIGIT (VSTM3) is the most well-characterized member, known to downregulate T cell-mediated immune responses against cancer cells . Recent research indicates that other VSTM family members, including VSTM2A, VSTM2B, VSTM2L, and VSTM4, also exhibit immunosuppressive activity, particularly on T cell activation .

A comparative analysis of the inhibitory activity of different VSTM family members reveals:

VSTM Family MemberDemonstrated Immunosuppressive Activities
VSTM2ASuppresses IFN-gamma secretion by T cells
VSTM2BSuppresses IFN-gamma and IL-2 secretion by T cells; Inhibits T cell proliferation
VSTM2LSuppresses IFN-gamma secretion by T cells
TIGIT (VSTM3)Downregulates T cell-mediated immune response; Binds CD155/PVR
VSTM4Suppresses IFN-gamma and IL-2 secretion by T cells

While these VSTM proteins share some functional similarities in terms of immunosuppressive effects, they may employ different mechanisms and have distinct binding partners. For instance, TIGIT is known to bind CD155/PVR, whereas the binding partners for VSTM2B and other family members have not been definitively identified in the current literature .

What methodological approaches are recommended for studying VSTM2B's immunosuppressive functions?

When investigating VSTM2B's immunosuppressive functions, several methodological approaches can be employed:

  • T Cell Activation Assays: Measure the effect of recombinant VSTM2B on T cell activation markers using:

    • IFN-gamma ELISA or ELISpot to quantify cytokine production

    • Flow cytometry to assess surface activation markers (CD69, CD25)

    • CFSE dilution assays to measure T cell proliferation

  • Dose-Response Studies: Establish ED50 values using titration of recombinant VSTM2B protein. For example, research has shown that recombinant Human VSTM2B Fc Chimera inhibits anti-CD3 antibody-induced IFN-gamma production with an ED50 of 1.5-7.5 μg/mL .

  • Binding Partner Identification:

    • Co-immunoprecipitation experiments

    • Yeast two-hybrid screening

    • Protein microarray approaches

    • Surface plasmon resonance (SPR) to measure binding kinetics

  • Functional Neutralization Studies:

    • Use of blocking antibodies against VSTM2B

    • VSTM2B gene knockout or knockdown approaches

When conducting these studies, it's critical to consider experimental design factors that might influence results, including:

  • Selection of appropriate controls (isotype-matched Fc chimera proteins)

  • Use of multiple T cell donors to account for donor variability

  • Validation of findings across different activation conditions

What are the best practices for experimental design when working with recombinant VSTM2B?

When designing experiments with recombinant VSTM2B, researchers should consider the following best practices:

  • Protein Format Selection: Different recombinant formats (His-tagged, Fc chimera, etc.) may impact experimental outcomes. For example:

    • His-tagged proteins minimize interference with functional domains but may have shorter half-lives

    • Fc-chimera proteins offer increased stability and detection options but may introduce confounding Fc-receptor interactions

    • Carrier-free formulations (CF) should be used for applications where BSA might interfere

  • Sample Preparation and Handling:

    • Follow recommended reconstitution procedures (e.g., reconstitute lyophilized VSTM2B at 500 μg/mL in PBS)

    • Avoid repeated freeze-thaw cycles to maintain protein activity

    • Consider protein stability under experimental conditions

  • Controls and Validation:

    • Include appropriate negative controls (buffer only, irrelevant proteins of similar structure)

    • Use positive controls (known immune checkpoint inhibitors)

    • Validate findings with multiple technical and biological replicates

    • Consider both dose-dependent and time-dependent effects

  • Quality Control:

    • Verify protein integrity via SDS-PAGE (Recombinant Human VSTM2B Fc Chimera shows bands at 62-70 kDa under reducing conditions and 120-140 kDa under non-reducing conditions)

    • Confirm bioactivity using established assays (e.g., inhibition of IFN-gamma secretion)

How can gene expression profiling be applied to study VSTM2B's role in immune regulation?

Gene expression profiling represents a powerful approach to investigate VSTM2B's role in immune regulation across different physiological and pathological contexts. When applying this methodology, researchers should consider the following:

  • Experimental Design Considerations:

    • Clear hypothesis formulation and specific research questions

    • Adequate sample size determination based on expected effect sizes

    • Control for confounding factors (age, sex, disease status, treatment conditions)

    • Randomization and balanced design to minimize systematic bias

    • Inclusion of both biological and technical replicates

  • Data Processing and Analysis Approaches:

    • Selection of appropriate normalization methods (global median, linear/non-linear intensity dependent, rank invariant)

    • Data transformation to stabilize variance (log transformation, generalized-log, started-log, log-linear hybrid)

    • Statistical testing beyond simple fold-change analysis (t-tests, ANOVA)

    • Multiple testing correction to control false discovery rate

  • Specific Applications for VSTM2B Research:

    • Comparing transcriptional profiles of T cells exposed to VSTM2B versus controls

    • Identifying genes differentially regulated downstream of VSTM2B signaling

    • Characterizing cell types expressing VSTM2B receptors

    • Investigating VSTM2B expression patterns across tissues and disease states

It's important to note that different preprocessing procedures may affect outcomes, and statistical approaches should consider the underlying variability in the data rather than relying solely on fold-change measurements .

What is the potential significance of VSTM2B in cancer immunology?

The demonstrated immunosuppressive functions of VSTM2B suggest potential significance in cancer immunology, particularly in the context of tumor immune evasion mechanisms. Given that TIGIT (VSTM3) plays a central role in downregulating T cell-mediated immune responses against cancer cells , other VSTM family members like VSTM2B that exhibit similar inhibitory activity warrant investigation as potential immune checkpoint molecules in the tumor microenvironment.

The inhibitory effects of VSTM2B on T cell activation, including suppression of IFN-gamma and IL-2 secretion and inhibition of T cell proliferation , align with mechanisms used by tumors to escape immune surveillance. If VSTM2B is expressed or upregulated in tumor tissues or tumor-infiltrating immune cells, it could contribute to an immunosuppressive microenvironment that limits anti-tumor immune responses.

Research methodologies to investigate VSTM2B in cancer contexts should include:

  • Analysis of VSTM2B expression across tumor types and correlation with immune infiltration

  • Assessment of prognostic significance of VSTM2B expression in patient cohorts

  • Functional studies evaluating the impact of VSTM2B blockade on anti-tumor immunity

How might recombinant VSTM2B be utilized in immune checkpoint research?

Recombinant VSTM2B proteins represent valuable tools for immune checkpoint research and potential therapeutic development:

  • Mechanistic Studies:

    • Recombinant VSTM2B can be used to identify binding partners through protein-protein interaction studies

    • Structure-function analyses to define critical domains for immunomodulatory activity

    • Signaling pathway elucidation downstream of VSTM2B engagement

  • Therapeutic Development Pipeline:

    • Generation and screening of antibodies that block VSTM2B-mediated immunosuppression

    • Development of soluble VSTM2B receptors as potential immunomodulatory agents

    • Creation of chimeric antigen receptor (CAR) T cells resistant to VSTM2B inhibition

  • Biomarker Development:

    • Utilization of recombinant VSTM2B in assays to measure anti-VSTM2B antibodies in patient samples

    • Development of immunoassays to quantify soluble VSTM2B in biological fluids

The availability of diverse recombinant VSTM2B formats, including His-tagged, Fc-chimera, and carrier-free preparations , provides researchers with options suitable for different experimental applications in immune checkpoint research.

What are the challenges in producing and working with recombinant VSTM2B?

Working with recombinant VSTM2B presents several technical challenges that researchers should be aware of:

  • Production Considerations:

    • Expression system selection impacts glycosylation patterns and protein folding

    • Different expression hosts (HEK293, CHO, NS0) may yield proteins with varying biological activities

    • Tag selection (His, Fc, HA) influences protein stability, detection, and function

  • Stability and Storage:

    • Recombinant VSTM2B proteins are typically lyophilized and require proper reconstitution

    • Storage considerations include avoiding repeated freeze-thaw cycles

    • Protein may exhibit time-dependent loss of activity under certain experimental conditions

  • Functional Assessment:

    • Ensuring batch-to-batch consistency in immunosuppressive activity

    • Potential interference from tags or fusion partners in functional assays

    • Need for appropriate positive and negative controls

  • Specificity Considerations:

    • Cross-reactivity with other VSTM family members due to structural similarities

    • Species-specificity issues when translating between human and animal models

    • Possible off-target effects in complex biological systems

When working with commercially available recombinant VSTM2B, researchers should carefully follow manufacturer recommendations for reconstitution, storage, and experimental use to maintain optimal protein activity .

How can researchers validate the bioactivity of recombinant VSTM2B preparations?

Validating the bioactivity of recombinant VSTM2B preparations is essential to ensure experimental reproducibility and reliable results. Several approaches can be employed:

  • Functional Assays:

    • Inhibition of anti-CD3 antibody-induced IFN-gamma production in human PBMCs, with expected ED50 values of 1.5-7.5 μg/mL for Recombinant Human VSTM2B Fc Chimera

    • Suppression of IL-2 secretion by activated T cells

    • Inhibition of T cell proliferation assays

  • Biochemical Validation:

    • SDS-PAGE analysis under reducing and non-reducing conditions to confirm expected molecular weight patterns (62-70 kDa under reducing conditions and 120-140 kDa under non-reducing conditions for the Fc chimera)

    • Western blot analysis using specific antibodies

    • Mass spectrometry to confirm protein identity and purity

  • Binding Assays:

    • ELISA or flow cytometry-based binding assays to known interacting partners

    • Surface plasmon resonance to determine binding kinetics

    • Cell-based binding assays using reporter systems

  • Comparative Analysis:

    • Side-by-side comparison with reference standards or previous lots

    • Dose-response curves to establish consistent potency metrics

    • Comparison across different expression systems or tag configurations

Researchers should establish standardized validation protocols specific to their experimental systems to ensure consistent bioactivity assessment across studies.

What are the key unanswered questions about VSTM2B biology?

Despite growing understanding of VSTM2B's immunosuppressive functions, several key questions remain unanswered:

  • Receptor-Ligand Interactions:

    • What are the binding partners/receptors for VSTM2B?

    • How do binding kinetics compare with other immune checkpoint interactions?

    • Are there soluble forms of VSTM2B with immunomodulatory functions?

  • Expression Patterns:

    • Which cell types express VSTM2B under normal and pathological conditions?

    • How is VSTM2B expression regulated at transcriptional and post-transcriptional levels?

    • Are there tissue-specific expression patterns relevant to disease contexts?

  • Signaling Mechanisms:

    • What intracellular signaling pathways are triggered by VSTM2B engagement?

    • How does VSTM2B integrate with other immunoregulatory networks?

    • What is the structure-function relationship for different domains?

  • Physiological and Pathological Roles:

    • What is the role of VSTM2B in normal immune homeostasis?

    • How might VSTM2B contribute to autoimmunity, cancer, or infectious disease outcomes?

    • Is VSTM2B dysregulated in specific disease states?

  • Therapeutic Potential:

    • Can VSTM2B blockade enhance anti-tumor immunity?

    • Are there disease contexts where VSTM2B agonism might be beneficial?

    • How does VSTM2B targeting compare with established immune checkpoint blockade approaches?

Addressing these questions will require integrated approaches combining structural biology, molecular techniques, and in vivo disease models.

What methodological advances would accelerate VSTM2B research?

Several methodological advances could significantly accelerate research into VSTM2B biology and therapeutic applications:

  • Development of High-Quality Research Tools:

    • Generation of specific monoclonal antibodies for detection and functional blockade

    • Creation of reporter systems for monitoring VSTM2B-mediated signaling

    • Development of conditional knockout mouse models

  • Advanced Imaging Approaches:

    • Live-cell imaging to track VSTM2B dynamics during immune cell interactions

    • Super-resolution microscopy to define spatial organization of VSTM2B at immune synapses

    • Intravital imaging to monitor VSTM2B function in vivo

  • Single-Cell Analysis Technologies:

    • Single-cell transcriptomics to define VSTM2B expression at cellular resolution

    • Single-cell proteomics to map VSTM2B-mediated signaling networks

    • Spatial transcriptomics to characterize VSTM2B expression in tissue contexts

  • Improved Experimental Design and Analysis:

    • Standardized protocols for assessing VSTM2B function across laboratories

    • More sophisticated statistical methods for analyzing complex immunological datasets

    • Integration of multiple data types through systems biology approaches

  • Translational Research Frameworks:

    • Biobanking initiatives that include VSTM2B expression profiling

    • Patient-derived models to study VSTM2B in relevant disease contexts

    • Early-phase clinical trial designs for VSTM2B-targeting therapeutics

These methodological advances would help address current knowledge gaps and accelerate progress toward potential therapeutic applications of VSTM2B modulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.