Recombinant Human V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant human V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) is a genetically engineered form of the human ATP6V0C protein, a critical subunit of the vacuolar ATPase (V-ATPase) complex. V-ATPase is a multisubunit enzyme responsible for acidifying intracellular organelles (e.g., lysosomes, endosomes) by pumping protons across membranes, enabling processes like protein degradation, synaptic vesicle function, and ion homeostasis . ATP6V0C forms part of the V0 transmembrane domain, which facilitates proton translocation .

Gene and Protein Structure

  • Gene: Located on chromosome 16p13.3, spans ~1.7 kb with 4 exons .

  • Protein: 155 amino acids, 16 kDa molecular weight, 4 transmembrane domains (TMDs) .

  • Domains: Includes a proteolipid ring structure critical for proton channel activity .

Sequence Features:

FeatureDetails
Full SequenceMSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMI...
Transmembrane DomainsTMD1 (11–33), TMD2 (56–76), TMD3 (93–114), TMD4 (132–152)

Recombinant Production and Applications

Recombinant ATP6V0C is produced in systems like HEK-293 cells, wheat germ, or cell-free synthesis for research applications .

Key Applications

  1. Autophagy Studies: ATP6V0C knockdown in neuroblastoma cells disrupts lysosomal acidification, increasing LC3-II and α-synuclein aggregates .

  2. Neurodevelopmental Disorders: Heterozygous ATP6V0C variants impair V-ATPase activity, leading to epilepsy, corpus callosum hypoplasia, and motor dysfunction .

  3. Cancer Research: Somatic mutations in ATP6V0C are linked to tumor progression due to altered lysosomal pH and metabolic pathways .

Functional Insights

  • Knockdown Effects: Reduces LysoSensor fluorescence (indicating impaired lysosomal acidification) and increases seizure-like behavior in Drosophila .

  • Pathogenic Variants: Missense mutations (e.g., Ala22Thr) disrupt hydrogen bonding in TMD1, destabilizing the proteolipid ring and proton transport .

Table 1: Clinical and Experimental Findings

Study ModelKey ObservationCitation
Saccharomyces cerevisiaeReduced growth in high CaCl₂ media due to V-ATPase dysfunction
Caenorhabditis elegansMotor dysfunction, reduced lifespan
Human neuroblastoma cellsAccumulation of APP C-terminal fragments and α-synuclein aggregates

Challenges and Future Directions

  • Stability Issues: The Ala22Thr mutation decreases protein stability (ΔΔG = −0.76 kcal/mol) .

  • Therapeutic Potential: Gene therapy targeting ATP6V0C could address neurodevelopmental disorders linked to V-ATPase dysfunction .

References

  1. ATP6V0C gene structure and function - [UCSC Genome Browser] .

  2. Structural impact of Ala22Thr mutation - [Front. Mol. Neurosci. (2022)] .

  3. Recombinant protein specifications - [Antibodies-Online] .

  4. Neurodevelopmental disorder mechanisms - [Brain (2023)] .

  5. Somatic mutations in cancer - [COSMIC Database] .

  6. Autophagy and neurodegeneration - [PLoS One (2014)] .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order. We will then prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for customers.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know and we will prioritize the development of the specified tag.
Synonyms
ATP6V0C; ATP6C; ATP6L; ATPL; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
Full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Uniprot No.

Target Background

Function
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Gene References Into Functions
  1. Studies have revealed that the expression of ATP6V0C is elevated in prostate cancer (PC) cell lines exhibiting high metastatic potential compared to those with low metastatic potential, suggesting that ATP6V0C enhances metastatic capacity in prostate cancer cells. Its silencing effectively suppressed the migration and invasion of PC cells by inhibiting the function of V-ATPase, independent of a LASS2/TMSG1-dependent mechanism. PMID: 29138865
  2. RBP2 has been shown to induce epithelial-mesenchymal transition in esophageal cancer cells and exert a greater effect on the expression of E-cadherin in lung squamous cells compared to esophageal squamous cells. PMID: 26264242
  3. Data demonstrate that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibits cell growth by regulating the expression of KLF4/LASS2/V-ATPase proteins in breast cancer. PMID: 26110566
  4. The impact of pharmacological inhibition of v-ATPase (using concanamycin) on proliferation, migration, VEGF-receptor 2 (VEGFR2) trafficking and signaling, as well as Notch-mediated transcription in endothelial cells, was investigated. PMID: 24254321
  5. A role for ATP6V0C in maintaining constitutive and stress-induced ALP function has been established. PMID: 24695574
  6. siRNA knockdown of ATP6V0C resulted in nearly complete loss of infectious virus production, suggesting that a human cytomegalovirus microRNA targets a critical cellular factor essential for virus replication. PMID: 24385903
  7. Findings indicate that inhibition of V-ATPase by archazolid reduces the activity of prometastatic proteases like cathepsin B both in vitro and in vivo. PMID: 24166050
  8. Results support the conclusion that LASS2/TMSG1 regulates V-ATPase activity and intracellular pH through the direct interaction of its homeodomain and the C subunit of V-ATPase. PMID: 22991218
  9. Data suggest that the bacterial effector VepA targets subunit c of V-ATPase, leading to the rupture of host cell lysosomes and subsequent cell death. PMID: 22829766
  10. ATP6L plays a protective role against SNP-induced autophagic cell death by inhibiting JNK and p38 in GSH-depleted glial cells. PMID: 21433058
  11. This gene has been identified as a potential candidate gene for myoclonic epilepsy, but no mutations have been found. PMID: 21087195
  12. HRG-1 regulates V-ATPase activity, which is crucial for endosomal acidification, heme binding, and receptor trafficking in mammalian cells. PMID: 19875448
  13. 16K expression inhibits beta(1) integrin surface expression and spreading on matrix through a novel mechanism that reduces levels of functional beta(1) integrin. PMID: 15466867
  14. Tumor acidity has a role in regulating and inhibits the expression of ATP6L mRNA and protein in breast tumor cells. PMID: 19299075

Show More

Hide All

Database Links

HGNC: 855

OMIM: 108745

KEGG: hsa:527

STRING: 9606.ENSP00000329757

UniGene: Hs.389107

Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is the structural role of ATP6V0C in the V-ATPase complex?

ATP6V0C serves as the c-subunit in the membrane-bound integral V0 domain of the V-ATPase. It forms the proteolipid c-ring that cooperates with the a-subunit to create a hemichannel for proton transfer . This c-ring is essential for the rotational mechanism of the V-ATPase. Structurally, ATP6V0C contains multiple transmembrane domains with a critical glutamic acid residue that undergoes cycles of protonation and deprotonation during the proton pumping process .

The c-ring structure interacts extensively with ATP6AP1 (also known as Ac45), which serves as a structural hub connecting multiple V0 subunits and phospholipids inside the c-ring . This arrangement is critical for the assembly and stability of the entire V-ATPase complex.

How does ATP6V0C contribute to cellular pH regulation?

ATP6V0C plays a pivotal role in generating proton gradients across membranes, which is essential for:

  • Acidification of intracellular compartments including lysosomes, endosomes, and secretory vesicles

  • Synaptic vesicle proton gradient generation

  • Regulation of intra and extracellular pH values

  • Protein sorting and receptor-mediated endocytosis

  • Zymogen activation in secretory pathways

The c-ring rotation driven by ATP hydrolysis in the V1 complex facilitates proton transfer through the a-subunit/c-ring interface, allowing for coupled proton transport across membranes .

What is the tissue distribution and expression pattern of ATP6V0C?

ATP6V0C is highly expressed in the brain, with predominant expression in the cerebral cortex throughout the human lifespan . It is also widely distributed in various cellular compartments including:

  • Lysosomes

  • Endosomes

  • Golgi-derived vesicles

  • Secretory vesicles

  • Plasma membrane in certain cell types

This ubiquitous distribution reflects the essential role of V-ATPases in cellular physiology and the importance of ATP6V0C in maintaining proper organelle acidification across diverse tissues.

Experimental Methods and Techniques

To assess ATP6V0C-dependent V-ATPase activity, researchers can employ multiple complementary approaches:

  • LysoSensor fluorescence assay: This method measures organelle acidification, with fluorescence values normalized to wild-type conditions. Statistical analysis using one-sample t-tests can compare variant constructs to wild-type controls with appropriate Bonferroni corrections for multiple comparisons .

  • Growth rate assays: Particularly in yeast models, growth can be measured in media containing varying concentrations of CaCl₂ (e.g., 5 mM, 100 mM, 200 mM). Effective area under the curve (eAUC) values should be normalized to wild-type controls .

  • Proton transfer activity measurement: Direct assessment of proton pumping using pH-sensitive dyes or electrodes in reconstituted systems can provide quantitative measures of ATP6V0C function .

  • ATP hydrolysis coupling assays: These measure how effectively ATP hydrolysis in the V₁ domain is coupled to proton transport in the V₀ domain, providing insights into the functional integrity of the entire complex .

What techniques are available for structural analysis of ATP6V0C and its variants?

Researchers investigating ATP6V0C structure and variants can utilize:

  • Cryo-electron microscopy (cryo-EM): This has proven highly effective for resolving V-ATPase structures at high resolution (up to 2.9 Å), revealing detailed protein-protein interactions and conformational states .

  • Mass spectrometry: This approach can identify post-translational modifications, glycosylation patterns, and lipid interactions involving ATP6V0C .

  • In silico modeling: Computational methods like Phyre2 can predict structural consequences of variants, particularly for transmembrane domain mutations that may disrupt protein stability or interactions .

  • Molecular dynamics simulations: These can model how variants affect conformational dynamics and interactions with other subunits or lipids over time.

What types of ATP6V0C variants have been associated with human disease?

Pathogenic variants in ATP6V0C have been identified in patients with neurodevelopmental disorders and epilepsy. These include:

  • Missense variants: Most commonly observed in patients, particularly affecting the transmembrane domains. The fourth transmembrane domain appears to be a variant hotspot .

  • Frameshifting variants: Four patients with frameshifting variants have been reported .

  • Stop-loss variant: One patient has been reported with a stop-loss variant that escapes nonsense-mediated decay .

  • Mosaic variants: Four patients were found to be mosaic for their identified ATP6V0C variants, suggesting that complete loss of normal ATP6V0C function may be incompatible with life .

Table 2: Selected Pathogenic ATP6V0C Variants and Associated Phenotypes

VariantTypeClinical PresentationFunctional EffectReference
p.Ala22ThrMissenseFebrile seizures, epilepsyAffects proteolipid c-ring structure and protein stability
p.Thr121Profs*7FrameshiftFebrile seizures, epilepsyLoss of function by premature termination
p.A138P, p.A149T, p.L150FMissense (recurrent)Neurodevelopmental disorders, epilepsyDisruption of V-ATPase function

What phenotypes are associated with ATP6V0C mutations?

Patients with ATP6V0C variants present with a spectrum of clinical features:

  • Neurodevelopmental abnormalities: Including developmental delay and intellectual disability .

  • Epilepsy: Both febrile seizures and afebrile seizures (including myoclonic seizures) .

  • Corpus callosum hypoplasia: Present in some patients .

  • Cardiac abnormalities: Observed in a subset of patients .

In patients with febrile seizures and epilepsy with febrile seizures plus (EFS+), first seizures typically occurred at 7-8 months of age. Some patients later developed afebrile seizures that responded well to lamotrigine treatment. Importantly, these patients generally displayed favorable outcomes without intellectual or developmental abnormalities, despite experiencing afebrile or frequent seizures .

How do ATP6V0C mutations affect V-ATPase function?

Pathogenic variants in ATP6V0C impact V-ATPase function through several mechanisms:

  • Disrupted subunit interactions: In silico modeling suggests that patient variants interfere with interactions between ATP6V0C and ATP6V0A subunits during ATP hydrolysis .

  • Reduced V-ATPase activity: Functional analyses in yeast revealed reduced LysoSensor fluorescence and reduced growth in media containing varying concentrations of CaCl₂, consistent with decreased V-ATPase activity .

  • Neuronal hyperexcitability: Knockdown of ATP6V0C in Drosophila resulted in increased duration of seizure-like behavior, suggesting a role in neuronal excitability regulation .

  • Compromised proteolipid c-ring: Missense mutations located in the c-ring can affect hydrogen bonding with surrounding residues and protein stability .

  • Premature protein termination: Frameshift mutations can result in loss of function by yielding a premature termination of the protein .

How does ATP6V0C contribute to V-ATPase assembly and biogenesis?

ATP6V0C plays a crucial role in V-ATPase assembly through its interactions with ATP6AP1, which functions as a structural hub:

  • ATP6AP1 interactions: ATP6AP1 connects to multiple V₀ subunits and phospholipids inside the c-ring, serving as a central player in V-ATPase biogenesis and stability .

  • Glycosylation: N-linked glycans on V₀ subunits form a luminal glycan coat critical for V-ATPase folding, localization, and stability. Mutations affecting glycosylation sites result in increased proteasomal degradation, ER retention, and failed incorporation into V-ATPases .

  • Lipid interactions: Glycolipids and phospholipids are essential components of the V-ATPase. Specific lipid interactions with the c-ring can regulate V-ATPase biogenesis and protect it from degradation by lysosomal hydrolases .

  • Transmembrane domain assembly: The proper assembly of transmembrane domains in ATP6V0C is critical for c-ring formation and subsequent assembly of the complete V-ATPase complex.

What is the role of ATP6V0C in neuronal function and excitability?

ATP6V0C influences neuronal function through several mechanisms:

  • Synaptic vesicle acidification: ATP6V0C is crucial for generating the proton gradient necessary for neurotransmitter loading into synaptic vesicles .

  • Neurotransmitter storage/secretion: Studies of the zebrafish ortholog revealed that ATP6V0C2 is associated with neurotransmitter storage/secretion and involved in the control of neuronal excitability .

  • Seizure susceptibility: Knockdown of ATP6V0C in Drosophila resulted in increased duration of seizure-like behavior, indicating a role in regulating neuronal excitability thresholds .

  • pH homeostasis: By maintaining appropriate pH in neuronal compartments, ATP6V0C contributes to proper protein trafficking, receptor recycling, and neurotransmitter metabolism.

How do lipid interactions affect ATP6V0C function?

Lipid interactions are crucial for ATP6V0C function and V-ATPase assembly:

  • Phospholipid binding: Structural studies have identified phospholipids interacting with ATP6V0C. One phospholipid binding site where a tyrosine residue coordinates the phosphate group has been shown to be critical, with mutation leading to ~60% loss of proton transfer activity .

  • Glycolipid associations: Monosialoganglioside GM1 molecules have been detected between the a-CTD and the c-ring, suggesting a role in V-ATPase regulation .

  • Lipid raft association: Association with specialized membrane domains may regulate V-ATPase distribution and activity in different cellular compartments.

  • Membrane integration: Proper integration of ATP6V0C into membranes requires specific lipid environments, which may be tissue or compartment-specific.

How can researchers validate the pathogenicity of novel ATP6V0C variants?

A multi-faceted approach is recommended for validating novel ATP6V0C variants:

  • Genetic evidence:

    • Co-segregation analysis in families

    • Comparison of variant frequency to control populations

    • Recurrence of variants in unrelated individuals with similar phenotypes

  • In silico prediction tools:

    • Protein modeling using Phyre2 to assess structural impacts

    • Evolutionary conservation analysis

    • Prediction of effects on protein stability and function

  • Functional validation:

    • LysoSensor fluorescence assays to measure acidification

    • Growth assays in yeast models

    • Electrophysiological studies in neuronal models

    • Analysis of protein expression and stability

  • Animal models:

    • Testing variants in Drosophila, C. elegans, or zebrafish

    • Assessing behaviors relevant to human phenotypes (seizures, motor function)

    • Measuring lifespan and developmental outcomes

What statistical approaches are appropriate for analyzing ATP6V0C variant data?

Researchers should employ robust statistical methods for ATP6V0C studies:

  • For LysoSensor fluorescence data: One-sample t-tests comparing variant constructs to wild-type controls (normalized to 100%), with Bonferroni corrections for multiple comparisons (e.g., α = 0.0003125) .

  • For growth rate assays: Normalization of effective area under the curve (eAUC) values to wild-type controls, with appropriate significance thresholds for different conditions (e.g., 5 mM CaCl₂: α = 0.0003125; 100 mM: α = 0.00714; 200 mM: α = 0.00833) .

  • For recovery time in Drosophila models: One-way ANOVA with Dunnett's post hoc test for multiple comparisons, normalizing to vehicle-only controls .

  • For variant hotspot identification: Fisher's exact test to demonstrate the presence of variant hotspots, such as in the fourth transmembrane domain of ATP6V0C .

  • For clinical data correlation: Appropriate non-parametric tests for small sample sizes and potentially non-normally distributed data.

How can researchers distinguish ATP6V0C-related epilepsy from other genetic epilepsies?

Distinguishing ATP6V0C-related epilepsy from other genetic epilepsies requires attention to specific features:

  • Clinical presentation:

    • Early onset of febrile seizures (typically at 7-8 months)

    • Development of myoclonic seizures

    • Generally favorable outcomes without intellectual or developmental abnormalities

    • Good response to lamotrigine

  • Differential diagnosis:

    • Screening for ATP6V0C mutations can help differentiate from Dravet syndrome caused by SCN1A mutations, which presents with similar clinical manifestations but different responses to antiepileptic treatment

  • Biomarkers:

    • Functional studies of V-ATPase activity in patient-derived cells

    • pH measurements in relevant cellular compartments

    • Analysis of lysosomal enzyme activity as a downstream measure of V-ATPase function

  • Treatment response patterns:

    • Documentation of seizure types and their response to specific anticonvulsants

    • Monitoring of long-term developmental outcomes

    • Assessment of seizure triggers and patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.