Recombinant Human V-type proton ATPase subunit S1 (ATP6AP1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ATP6AP1; ATP6IP1; ATP6S1; VATPS1; XAP3; V-type proton ATPase subunit S1; V-ATPase subunit S1; Protein XAP-3; V-ATPase Ac45 subunit; V-ATPase S1 accessory protein; Vacuolar proton pump subunit S1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
42-470
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
EQQVPLVLWSSDRDLWAPAADTHEGHITSDLQLSTYLDPALELGPRNVLLFLQDKLSIED FTAYGGVFGNKQDSAFSNLENALDLAPSSLVLPAVDWYAVSTLTTYLQEKLGASPLHVDL ATLRELKLNASLPALLLIRLPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDVPYTAAL TAVRPSRVARDVAVVAGGLGRQLLQKQPVSPVIHPPVSYNDTAPRILFWAQNFSVAYKDQ WEDLTPLTFGVQELNLTGSFWNDSFARLSLTYERLFGTTVTFKFILANRLYPVSARHWFT MERLEVHSNGSVAYFNASQVTGPSIYSFHCEYVSSLSKKGSLLVARTQPSPWQMMLQDFQ IQAFNVMGEQFSYASDCASFFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKG PTISLTQIV
Uniprot No.

Target Background

Function
Recombinant Human V-type proton ATPase subunit S1 (ATP6AP1) is an accessory subunit of the vacuolar (V)-ATPase proton pump, essential for acidifying secretory vesicle lumens. It guides the V-type ATPase to specialized compartments, such as neuroendocrine secretory vesicles and osteoclast ruffled borders, thereby regulating ATPase activity. ATP6AP1 is involved in membrane trafficking and Ca2+-dependent membrane fusion, and may play a role in V-type ATPase complex assembly. Under aerobic conditions, it contributes to intracellular iron homeostasis by influencing the activity of Fe2+ prolyl hydroxylase (PHD) enzymes, leading to HIF1A hydroxylation and subsequent proteasomal degradation.
Gene References Into Functions
  1. Studies suggest a correlation between the V-ATPase Ac45 subunit (ATP6AP1) assembly and immunoglobulin production and cognitive function. PMID: 27231034
  2. Somatic mutations in ATP6AP1 have been identified in approximately 12% of follicular lymphoma tumors, primarily clustered within the transmembrane domain. PMID: 25713363
  3. Research has demonstrated the involvement of ATP6AP1, along with other genes (AP3B1, BLOC1S1, LAMP2, and RAB11A), in the proper initiation of macroautophagy in amino acid-starved fibroblasts. PMID: 19246570
Database Links

HGNC: 868

OMIM: 300197

KEGG: hsa:537

STRING: 9606.ENSP00000358777

UniGene: Hs.633817

Involvement In Disease
Immunodeficiency 47 (IMD47)
Protein Families
Vacuolar ATPase subunit S1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane.
Tissue Specificity
widely expressed, with highest levels in brain and lowest in liver and duodenum.

Q&A

What is the structure and function of ATP6AP1 in V-ATPase complexes?

ATP6AP1 (ATPase H+ Transporting Accessory Protein 1), also known as Ac45, is a critical accessory subunit of the vacuolar-type ATPase (V-ATPase) complex. Structurally, ATP6AP1 is synthesized as a 62-kDa precursor protein that can be processed to different forms including a cleaved ~40-kDa form in neuronal tissue.

In V-ATPase complexes, ATP6AP1 functions as a structural hub connecting multiple Vo subunits and phospholipids inside the c-ring of the V-ATPase. High-resolution cryo-electron microscopy studies have revealed that ATP6AP1 positions within the c-ring, with its C-terminal tail emerging to interact with subunit d of the Vo complex .

ATP6AP1's functional roles include:

  • Facilitating V-ATPase assembly in the endoplasmic reticulum

  • Enabling proper incorporation of the d subunit

  • Maintaining structural stability of the V-ATPase complex

  • Serving as a GEF (guanine nucleotide exchange factor) for Rheb in mTORC1 signaling

These functions make ATP6AP1 essential for both V-ATPase activity and cellular signaling pathways beyond its structural role .

How does ATP6AP1 expression vary across different tissues and what are the implications?

ATP6AP1 shows remarkable tissue-specific expression patterns with significant implications for its function:

TissueATP6AP1 FormMolecular WeightImplications
BrainCleaved Ac45~40 kDaInvolved in neurotransmission
LiverIntact protein62 kDaAssociated with hepatic function
B cellsIntermediate form50 kDaLinked to immune function

This tissue-specific expression suggests specialized roles in different cellular contexts . For example:

  • In neuronal tissues, the cleaved ~40-kDa form predominates and is essential for proper synaptic vesicle acidification and neurotransmitter loading

  • In liver, the intact 62-kDa protein may have specialized functions related to hepatic metabolism

  • In immune cells, the intermediate 50-kDa isoform appears to be critical for immunoglobulin production

Research indicates that mRNA expression levels also differ significantly across tissues, with highest expression in brain and lowest in liver and duodenum . These expression differences may explain why ATP6AP1 mutations manifest with tissue-specific symptoms, particularly affecting liver function, neurological development, and immune responses.

What experimental models are most effective for studying ATP6AP1 function?

Several experimental models have proven effective for studying ATP6AP1 function, each with specific advantages:

Yeast Models:

  • S. cerevisiae with Voa1 mutations provide an excellent system for complementation studies

  • ATP6AP1 has been identified as the human homolog of yeast Voa1, allowing functional studies in a simplified system

  • The processed human Ac45 C-terminal domain can functionally complement Voa1-mutant yeast

Cellular Models:

  • Human cell lines (T-47D, MDA-MB-453, MCF-7) with stable ATP6AP1 knockdown via shRNA

  • CRISPR-Cas9 gene editing for complete ATP6AP1 knockout

  • Proximity labeling techniques like PhastID (Pyrococcus horikoshii biotin protein ligase-assisted biotin identification) for identifying ATP6AP1 interaction partners

Animal Models:

  • Mouse models with tissue-specific ATP6AP1 deletion

  • Zebrafish models for developmental studies

Patient-Derived Materials:

  • Fibroblasts from patients with ATP6AP1 mutations show altered redox status and disrupted peroxisomal and lysosomal function

  • Patient liver and brain tissues for analyzing tissue-specific protein forms

For functional analysis, researchers commonly employ a combination of these models, particularly using yeast for mechanistic studies and human cell lines for disease-relevant phenotypes.

What methodologies are available for purifying and analyzing recombinant ATP6AP1?

Researchers have several methodologies at their disposal for purifying and analyzing recombinant ATP6AP1:

Purification Approaches:

  • Bacterial expression systems using GST-tags for purification of specific domains (particularly the C-terminal domain)

  • Mammalian expression systems (HEK293T cells) for full-length protein with proper post-translational modifications

  • Isolation of intact V-ATPase complexes using SidK, a Legionella pneumophila effector protein that specifically binds the V-ATPase

Analytical Methods:

  • Western blotting using antibodies directed against the C-terminal half of ATP6AP1

  • Mass spectrometry for precise identification of post-translational modifications and processing

  • Native mass spectrometry for analysis of intact V-ATPase complexes containing ATP6AP1

  • Cryo-electron microscopy for structural analysis at near-atomic resolution

Activity Assays:

  • V-ATPase activity measurement using ATP hydrolysis rates

  • Lysosomal acidification assays using pH-sensitive fluorescent probes

  • GTP-binding assays using fluorescent GTP analogs to assess GEF activity

A particularly effective purification strategy developed by Abbas et al. (2020) involves isolating homogeneous V-ATPase complexes from rat brain through their interaction with SidK, enabling subsequent cryo-EM structure determination .

How is ATP6AP1 biogenesis and post-translational processing regulated?

ATP6AP1 undergoes complex biogenesis and post-translational processing that is regulated in a tissue-specific manner:

Synthesis and Initial Processing:

  • ATP6AP1 is initially synthesized as a 62-kDa precursor protein

  • In neuronal and neuroendocrine cells, this precursor is proteolytically processed to a cleaved ~40-kDa form (cleaved-Ac45)

  • Different tissues maintain distinct ratios of intact versus processed forms

Glycosylation:

  • ATP6AP1 contains N-glycosylation sites that are differentially modified across tissues

  • Patient fibroblasts with ATP6AP1 mutations show altered glycosylation patterns with a shift to higher molecular weight due to increased high-mannose/hybrid type N-glycosylation

  • Enzymatic treatments with PNGase F and Endo H have been used to characterize these modifications

Regulation Mechanisms:

  • Tissue-specific proteases likely control the differential processing

  • Localization to specific cellular compartments influences processing

  • Post-translational modifications may affect protein stability and function

Pathological Alterations:

  • Disease-causing mutations in ATP6AP1 can affect protein stability and processing

  • In patients with ATP6AP1-CDG (Congenital Disorder of Glycosylation), abnormal ATP6AP1 processing correlates with disease severity

Understanding these processing events is critical for interpreting experimental results, as different ATP6AP1 forms may have distinct functions in various cellular contexts.

What experimental approaches can detect interactions between ATP6AP1 and other V-ATPase subunits?

Several sophisticated experimental approaches have been developed to detect and characterize ATP6AP1 interactions with other V-ATPase subunits:

Proximity Labeling Techniques:

  • PhastID (Pyrococcus horikoshii biotin protein ligase-assisted biotin identification) allows detection of transient ATP6AP1 interactions in live cells

  • BioID and TurboID approaches using ATP6AP1 fusions can identify neighboring proteins in the V-ATPase complex

  • APEX2-based proximity labeling provides spatial resolution of interactions within membrane compartments

Immunoprecipitation-Based Methods:

  • Co-immunoprecipitation with antibodies against ATP6AP1 can pull down interacting V-ATPase components

  • Lyso-IP techniques can specifically isolate lysosomal membrane complexes containing ATP6AP1 and other V-ATPase subunits

  • Crosslinking immunoprecipitation (CLIP) can capture transient interactions

Structural Biology Approaches:

  • Cryo-electron microscopy has revealed ATP6AP1's position within the assembled V-ATPase complex at up to 2.9 Å resolution

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map interaction interfaces

  • Single-particle analysis of V-ATPase complexes with and without ATP6AP1 can identify structural changes

Computational Methods:

  • STRING database analysis can predict potential ATP6AP1 interaction partners

  • Protein-protein interaction (PPI) networks constructed using various bioinformatic tools can contextualize ATP6AP1 within the V-ATPase assembly pathway

For detecting specific subunit interactions, cryo-EM has been particularly illuminating, showing how ATP6AP1 and ATP6AP2/PRR interact with the c-ring and subunit d, creating a platform for V-ATPase assembly .

How can researchers accurately measure ATP6AP1-dependent V-ATPase activity in different experimental systems?

Lysosomal pH Measurement:

  • LysoSensor or LysoTracker dyes can be used to quantify lysosomal acidification in wild-type versus ATP6AP1-depleted cells

  • Ratiometric pH indicators provide more precise measurements of lysosomal pH changes

  • Flow cytometry analysis of pH-sensitive dyes allows quantification across large cell populations

ATP Hydrolysis Assays:

  • ATP consumption can be measured using enzyme-coupled assays that track changes in NADH absorbance

  • Comparing ATP hydrolysis rates in the presence or absence of V-ATPase inhibitors (e.g., bafilomycin) identifies ATP6AP1-dependent activity

  • Reconstitution of V-ATPase complexes with purified components can isolate ATP6AP1's contribution

Proton Transport Measurements:

  • Purified V-ATPase complexes can be reconstituted into liposomes containing pH-sensitive fluorescent dyes

  • Acridine orange quenching assays provide a readout of proton pumping activity

  • Patch-clamp techniques can measure proton currents in isolated membrane patches

Complementation Approaches:

  • Voa1-deficient yeast strains can be used to test functional recovery upon expression of wild-type or mutant forms of ATP6AP1

  • Growth assays in pH-dependent conditions (e.g., high pH media) can assess functional V-ATPase activity

  • Genetic rescue experiments in ATP6AP1-depleted cells using wild-type versus mutant ATP6AP1 constructs

What role does ATP6AP1 play in autophagy regulation and how can this be experimentally assessed?

ATP6AP1 plays a significant role in autophagy regulation through both its canonical V-ATPase function and through non-canonical pathways:

Mechanisms of ATP6AP1-Mediated Autophagy Regulation:

  • Maintenance of lysosomal acidification necessary for functional autophagy

  • Interaction with mTORC1 signaling through its GEF activity toward Rheb

  • Possible direct interactions with autophagy proteins or regulators

Experimental Assessment Methods:

  • Autophagic Flux Analysis:

    • Western blotting for LC3-I to LC3-II conversion and p62/SQSTM1 degradation

    • mRFP-GFP-LC3 fluorescence assays to monitor autophagosome-lysosome fusion

    • Comparison of autophagic markers with and without lysosomal inhibitors like chloroquine or bafilomycin A1

  • Microscopy-Based Methods:

    • Immunofluorescence analysis of autophagosome and autolysosome formation

    • Live-cell imaging to track autophagic vesicle dynamics

    • Transmission electron microscopy to visualize autophagic structures at the ultrastructural level

  • Biochemical Assays:

    • Long-lived protein degradation assays to measure autophagic activity

    • Lysosome-specific cathepsin activity assays to assess lysosomal function

    • In vitro reconstitution of autophagosome-lysosome fusion

  • Genetic Approaches:

    • ATP6AP1 knockdown followed by autophagy induction or inhibition

    • Rescue experiments using wild-type versus mutant ATP6AP1 constructs

    • Epistasis experiments with other autophagy regulators

Recent studies have shown that ATP6AP1 knockdown increases autophagy in cancer cells, contributing to doxorubicin resistance. Autophagy assessment in ATP6AP1-depleted cells demonstrates increased LC3B and p62/SQSTM1 levels, resembling the pattern seen with chloroquine or bafilomycin A1 treatment . This suggests ATP6AP1 may be a potential target for modulating autophagy in cancer treatment contexts.

What methodological approaches can differentiate between ATP6AP1's roles in V-ATPase function versus mTORC1 signaling?

Differentiating between ATP6AP1's roles in V-ATPase function and mTORC1 signaling requires careful experimental design and specific methodological approaches:

Domain-Specific Mutant Analysis:

  • Expressing ATP6AP1 with mutations in the C-terminal tail (particularly the tri-aspartate motif) disrupts its GEF activity toward Rheb without affecting V-ATPase assembly or proton pumping

  • The ATP6AP1 ΔC-tail and tri-aspartate (3D/A) mutants can restore lysosomal acidification but not mTORC1 signaling

  • These domain-specific mutants allow selective disruption of one function while preserving the other

Rescue Experiments:

  • In ATP6AP1-knockdown cells, reconstitution with constitutively active Rheb (CA-Rheb) can bypass the requirement for ATP6AP1's GEF activity

  • Expression of CA-Rheb in cells expressing ATP6AP1ΔC can restore mTORC1-dependent processes without affecting V-ATPase function

Selective Pathway Inhibition:

  • V-ATPase inhibitors (bafilomycin, concanamycin) can be used to block proton pumping while potentially preserving GEF activity

  • Rapamycin directly inhibits mTORC1 downstream of Rheb activation by ATP6AP1

  • Comparing phenotypes between these inhibition methods helps distinguish pathway-specific effects

Readout Specificity:

  • V-ATPase function can be monitored using lysosomal pH measurements

  • mTORC1 signaling can be assessed by phosphorylation of S6K, S6, and 4EBP1

  • Comparing these distinct readouts in the same experimental system can separate the pathways

Temporal Analysis:

  • Acute versus chronic ATP6AP1 depletion may differentially affect these pathways

  • Time-course experiments following ATP6AP1 manipulation can reveal primary versus secondary effects

A key experimental approach demonstrated by Wang et al. (2024) showed that ATP6AP1's C-terminal 3D/A mutant failed to activate mTORC1 signaling but successfully restored lysosomal pH, providing strong evidence for a functional separation between these roles .

What are the most reliable experimental systems for investigating ATP6AP1's role in cancer progression?

For investigating ATP6AP1's role in cancer progression, several experimental systems have proven particularly reliable, each offering unique advantages:

Cell Line Models:

  • Breast cancer cell lines (MCF-7, T-47D, MDA-MB-231, MDA-MB-436, MDA-MB-453) with stable ATP6AP1 knockdown or overexpression

  • Comparison with non-tumorigenic mammary epithelial cells (MCF10A) for baseline expression

  • Patient-derived cancer cell lines that maintain original tumor heterogeneity

3D Culture Systems:

  • Spheroid cultures to assess anchorage-independent growth following ATP6AP1 modulation

  • Organoid models derived from patient tumors

  • Co-culture systems incorporating cancer and stromal cells to model the tumor microenvironment

Functional Assays:

  • Migration and invasion assays (wound healing, transwell) to assess ATP6AP1's impact on metastatic potential

  • Drug resistance assays, particularly with doxorubicin, to evaluate ATP6AP1's role in chemoresistance

  • Autophagy assessment to connect ATP6AP1 function with survival mechanisms

In Vivo Models:

  • Xenograft models using ATP6AP1-modulated cancer cells

  • Patient-derived xenografts for more clinically relevant tumor biology

  • Metastasis models to track cancer cell dissemination

Clinical Sample Analysis:

  • Tissue microarrays for immunohistochemical assessment of ATP6AP1 expression across cancer stages

  • Analysis of ATP6AP1 expression in paired primary and metastatic samples

  • Correlation of ATP6AP1 levels with response to chemotherapy in patient cohorts

Recent studies have demonstrated that ATP6AP1 is upregulated in multiple cancer types, with particularly high expression in breast invasive carcinoma, kidney chromophobe, and skin cutaneous melanoma. In breast cancer, higher ATP6AP1 expression correlates with more advanced disease stages and poorer prognosis . These findings underscore the value of using multiple experimental systems to comprehensively assess ATP6AP1's oncogenic functions.

How does ATP6AP1 function as a Rheb GEF in mTORC1 signaling, and what experimental approaches best characterize this activity?

ATP6AP1 functions as an unconventional guanine nucleotide exchange factor (GEF) for Rheb in mTORC1 signaling through a mechanism distinct from canonical GEFs:

Molecular Mechanism:

  • ATP6AP1 binds Rheb through its last 12 amino acids (C12 region)

  • The tri-aspartate motif (D454/D457/D458) in the C-terminal tail facilitates nucleotide exchange

  • Unlike canonical GEFs, ATP6AP1 enhances Rheb binding to GTP while inhibiting GDP association

  • The interaction is dynamically regulated by insulin/growth factor stimulation

Experimental Approaches for Characterizing GEF Activity:

  • Nucleotide Exchange Assays:

    • BODIPY-FL-labeled GTP/GDP analogs can be used to measure ATP6AP1-facilitated nucleotide exchange in real-time

    • GTPγS bead pull-down assays with purified Rheb in the presence of ATP6AP1 C-tail peptides

    • Comparison of wild-type versus mutant (particularly 3D/A) ATP6AP1 C-tail peptides

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation of endogenous and exogenous Rheb with ATP6AP1

    • Proximity labeling techniques (PhastID) to capture dynamic Rheb-ATP6AP1 interactions

    • Surface plasmon resonance or isothermal titration calorimetry for binding kinetics

  • Functional Readouts:

    • Phosphorylation of mTORC1 substrates (S6K, S6, 4EBP1) in response to ATP6AP1 modulation

    • Rescue experiments with constitutively active Rheb in ATP6AP1-depleted cells

    • Lysosomal recruitment of mTORC1 components visualized by immunofluorescence

  • Domain Mapping:

    • Deletion and point mutation analysis of ATP6AP1's C-terminal region

    • C-tail fusion proteins (e.g., LAMP1-C-tail, LAMP2-C-tail) to assess sufficiency for Rheb activation

    • Competitive inhibition using synthetic C-tail peptides

A groundbreaking experiment by Wang et al. (2024) demonstrated that a synthetic ATP6AP1 C-tail peptide significantly increased the amount of Rheb proteins associating with GTPγS, while the 3D/A mutant peptide failed to promote GTP binding despite retaining Rheb interaction capacity. This provides direct biochemical evidence for ATP6AP1's GEF activity toward Rheb .

What structural mechanisms explain how ATP6AP1 mutations lead to diverse clinical phenotypes in ATP6AP1-CDG?

ATP6AP1 mutations lead to a Congenital Disorder of Glycosylation (ATP6AP1-CDG) with diverse clinical manifestations. Several structural mechanisms explain this phenotypic diversity:

Tissue-Specific Protein Processing:

  • ATP6AP1 exists in different molecular forms across tissues (62-kDa in liver, 40-kDa in brain, 50-kDa in B cells)

  • Mutations may differentially impact these tissue-specific forms, explaining why some patients show predominantly hepatic, neurological, or immunological phenotypes

  • Disease-causing mutations can alter the balance between intact and processed forms

Structural Impact on V-ATPase Assembly:

  • ATP6AP1 serves as a structural hub connecting multiple V-ATPase subunits

  • Mutations in specific domains disrupt interaction with different V-ATPase components

  • Cryo-EM structures show that ATP6AP1 is essential for proper assembly of the Vo complex and for connecting the Vo and V1 regions

Altered Subcellular Localization:

  • Mutations can affect ATP6AP1 trafficking to lysosomes and other cellular compartments

  • Immunofluorescence studies in patient fibroblasts demonstrate abnormal localization patterns

  • Disrupted localization impairs V-ATPase assembly in specific organelles

Impact on Cellular Homeostasis Pathways:

  • ATP6AP1 mutations lead to increased reactive oxygen species in patient fibroblasts

  • Peroxisomal disturbances are evidenced by abnormal serum VLCFA levels and decreased catalase signals

  • Increased lysosomal abundance (shown by LAMP2 staining) indicates disrupted autophagy

Glycosylation Status Changes:

  • ATP6AP1 mutations alter protein N-glycosylation, with mutant proteins showing higher-molecular-weight shifts in gel mobility

  • Enzymatic treatments (PNGase F, Endo H) reveal abnormal high-mannose/hybrid type glycosylation

  • These glycosylation changes may affect protein stability and function

Patient studies have revealed that different mutations (e.g., p.L74P versus p.E346K) correlate with disease severity, with some mutations causing fatal liver failure before 1 year of age, while others lead to milder presentations with predominantly immunological or neurological symptoms .

How can researchers investigate the mechanisms by which ATP6AP1 contributes to chemoresistance in cancer cells?

Investigating ATP6AP1's role in chemoresistance requires multi-faceted experimental approaches focusing on several interconnected mechanisms:

Autophagy-Mediated Resistance Mechanisms:

  • Measure autophagic flux in ATP6AP1-high versus ATP6AP1-low cancer cells during chemotherapy

  • Track autolysosome formation and acidification using mRFP-GFP-LC3 reporter systems

  • Determine if autophagy inhibitors sensitize ATP6AP1-high cells to chemotherapy

  • Analyze autophagic cargo degradation efficiency in relation to ATP6AP1 expression

Drug Accumulation and Efflux:

  • Quantify intracellular drug concentrations in ATP6AP1-modulated cells

  • Assess expression and activity of drug efflux transporters in relation to ATP6AP1 levels

  • Use fluorescent drug analogs to track subcellular distribution and sequestration

  • Determine if lysosomal pH alterations affect drug accumulation in cancer cells

Cell Death Pathway Analysis:

  • Compare apoptotic, necroptotic, and other cell death pathways in ATP6AP1-high versus ATP6AP1-low cells

  • Measure cleaved PARP, caspase activation, and other death markers in response to therapy

  • Assess whether ATP6AP1 modulation alters the threshold for cell death induction

  • Use complementary cell death assays (flow cytometry, LDH release, cytotoxicity)

Clinical Correlation Studies:

  • Analyze ATP6AP1 expression in pre- and post-treatment patient samples

  • Correlate ATP6AP1 levels with response to chemotherapy and patient outcomes

  • Examine ATP6AP1 expression in relation to established chemoresistance markers

  • Perform multivariate analysis to identify ATP6AP1-associated resistance signatures

Intervention Studies:

  • Test if ATP6AP1 knockdown or inhibition enhances chemosensitivity

  • Evaluate synthetic C-tail peptides or domain-specific inhibitors as chemosensitizers

  • Develop combination approaches targeting both ATP6AP1 and autophagy pathways

  • Assess if ATP6AP1 inhibition shows synergy with specific chemotherapeutic agents

Recent studies have demonstrated that doxorubicin resistance in breast cancer cells correlates with increased autophagic flux and that ATP6AP1 knockdown reduces autophagy-mediated resistance by inhibiting autophagic flux and lysosomal acidification. Public database analyses show that lower ATP6AP1 expression is associated with better pathological complete response rates to doxorubicin-based neoadjuvant chemotherapy in breast cancer patients .

What computational approaches can predict the impact of ATP6AP1 mutations on protein function and disease outcomes?

Advanced computational approaches can help predict how ATP6AP1 mutations affect protein function and disease severity:

Structural Prediction Methods:

  • AlphaFold2 and RoseTTAFold can generate accurate ATP6AP1 structural models, especially when integrated with cryo-EM data

  • Molecular dynamics simulations predict how mutations disrupt protein stability and dynamics

  • FoldX and similar tools can calculate changes in folding energy (ΔΔG) to assess mutation impact

  • Structure-based prediction of mutation effects on protein-protein interfaces within the V-ATPase complex

Sequence-Based Prediction:

  • Multiple sequence alignment across species identifies evolutionarily conserved residues likely critical for function

  • Machine learning algorithms like SIFT, PolyPhen-2, and MutationTaster predict mutation pathogenicity

  • Conservation scores (PhyloP) help prioritize variants for functional follow-up

  • Variant Effect Predictor (VEP) pipelines incorporating multiple tools provide consensus predictions

Systems Biology Approaches:

  • Gene co-expression network analysis identifies ATP6AP1-associated gene modules

  • Pathway enrichment analysis using GSEA or similar methods reveals affected cellular processes

  • Protein-protein interaction networks built from experimental data contextualize mutation impact

  • Multi-omics integration (transcriptomics, proteomics, metabolomics) predicts system-wide effects

Clinical Outcome Prediction:

  • Nomogram construction based on Cox regression analyses incorporating ATP6AP1 expression or mutation status

  • ROC curve analysis to assess diagnostic/prognostic value of ATP6AP1 variants

  • Decision curve analysis (DCA) to evaluate nomogram performance

  • Random forest or neural network models trained on combined molecular and clinical data

Therapeutic Response Prediction:

  • Virtual screening for compounds targeting mutant ATP6AP1 or compensatory pathways

  • Network-based drug repurposing approaches identifying existing drugs that may counteract mutation effects

  • Patient stratification algorithms predicting response to therapy based on ATP6AP1 status

  • Systems pharmacology models incorporating ATP6AP1-dependent pathways

For ATP6AP1-CDG patients, computational methods have successfully distinguished severe from moderate phenotypes. The p.L74P mutation was predicted to be highly pathogenic (PhyloP score 5.1) and resulted in fatal liver failure before age 1, while p.E346K mutations were associated with more moderate but still serious phenotypes including hepatopathy, epilepsy, and mild intellectual disability .

What methodological challenges exist in studying the dual role of ATP6AP1 in V-ATPase assembly and Rheb activation?

Studying ATP6AP1's dual functionality presents several methodological challenges that require sophisticated experimental approaches:

Spatiotemporal Regulation:

Protein Complex Heterogeneity:

  • V-ATPase complexes contain numerous subunit isoforms in tissue-specific combinations

  • Mass spectrometry detection of all components in a single complex is challenging

  • Native mass spectrometry and cryo-EM require highly purified complexes

  • Heterogeneity makes it difficult to generalize findings across tissues or cell types

Separating Direct from Indirect Effects:

  • Disrupting ATP6AP1 affects both V-ATPase function and mTORC1 signaling

  • These pathways have reciprocal effects, creating complex feedback loops

  • Rapid, inducible systems for ATP6AP1 manipulation are needed to capture direct effects

  • Complementary approaches using domain-specific mutants help disentangle functions

Technical Limitations in Purification:

  • Membrane protein complexes are challenging to purify in native states

  • Detergent solubilization may disrupt important interactions

  • Alternative approaches like SidK-based purification have proven valuable but have limitations

  • Nanodiscs or similar technologies may better preserve native environments

Quantification Challenges:

  • Accurately measuring GEF activity requires specialized assays not widely available

  • V-ATPase activity measurement is complicated by the presence of other ion transporters

  • Linking biochemical activities to cellular phenotypes requires careful experimental design

  • New biosensors for local pH, ATP hydrolysis, and Rheb activation would advance the field

Disease-Relevant Models:

  • Patient cells may have compensatory mechanisms obscuring primary effects

  • Animal models with tissue-specific disruption of ATP6AP1 are underdeveloped

  • Reductionist in vitro systems may not capture the complexity of disease states

  • Integrating findings across multiple model systems is necessary but challenging

A breakthrough approach developed by Wang et al. (2024) involved creating ATP6AP1 mutants that selectively disrupt the GEF function while preserving V-ATPase assembly. This allowed demonstration that ATP6AP1's C-tail tri-aspartate mutant could restore lysosomal acidification but not mTORC1 signaling, providing a powerful tool for separating these functions .

What are the most promising approaches for developing therapeutic strategies targeting ATP6AP1 in cancer and other diseases?

Several promising therapeutic approaches targeting ATP6AP1 are emerging for both cancer and ATP6AP1-CDG:

For Cancer Treatment:

  • Direct ATP6AP1 Inhibition:

    • Development of small molecules targeting the ATP6AP1 C-terminal domain

    • Synthetic C-tail tri-aspartate mutant peptides as dominant-negative inhibitors

    • These approaches could block Rheb activation without disrupting V-ATPase assembly

    • Wang et al. demonstrated that overexpressing the C-tail tri-aspartate mutant peptide inhibited cancer cell anchorage-independent growth and migration

  • Combination Therapies:

    • ATP6AP1 inhibition combined with chemotherapeutics like doxorubicin

    • Dual targeting of ATP6AP1 and autophagy pathways

    • Synergistic approaches targeting both mTORC1 and V-ATPase functions

    • Preclinical evidence suggests ATP6AP1 knockdown increases doxorubicin sensitivity in breast cancer cells

  • Biomarker-Guided Strategies:

    • ATP6AP1 expression as a stratification marker for chemotherapy response

    • Tailoring treatment based on ATP6AP1-associated gene signatures

    • Targeting patients with ATP6AP1-high tumors with specific inhibitors

    • Multiple studies have shown ATP6AP1 correlation with prognosis and treatment response

For ATP6AP1-CDG Treatment:

  • Gene Therapy Approaches:

    • AAV-mediated delivery of functional ATP6AP1 to affected tissues

    • CRISPR-based correction of disease-causing mutations

    • Tissue-specific targeting based on dominant symptoms

  • Protein Replacement Strategies:

    • Recombinant ATP6AP1 protein delivery to affected tissues

    • Cell-penetrating peptide conjugates for enhanced delivery

    • Exosome-mediated protein replacement

  • Metabolic Modulation:

    • Targeting downstream metabolic disturbances (e.g., peroxisomal dysfunction)

    • Antioxidant therapies to address increased reactive oxygen species

    • Copper chelation therapy for patients with hepatic copper accumulation

  • Small Molecule Chaperones:

    • Compounds that stabilize mutant ATP6AP1 protein folding

    • Enhancement of residual function in partially functional mutants

    • Prevention of protein degradation to increase effective protein levels

  • Pathway-Based Interventions:

    • V-ATPase activators to compensate for reduced functionality

    • mTORC1 pathway modulation to address signaling imbalances

    • Autophagy regulation to correct lysosomal dysfunction

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.