Recombinant Human Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

Shipped with Ice Packs
In Stock

Description

Production and Applications

Recombinant VMA21 is typically expressed in heterologous systems (e.g., E. coli, yeast, or mammalian cells) for research and therapeutic applications. While human-specific recombinant VMA21 is not explicitly detailed in publicly available catalogs, its production mirrors methods used for orthologs:

  • Host Systems: E. coli, yeast, baculovirus, or mammalian cells .

  • Purity: ≥85% as determined by SDS-PAGE .

  • Applications:

    • Basic Research: Studying V-ATPase assembly, lysosomal acidification, and autophagy .

    • Therapeutic Development: Investigating genetic disorders linked to VMA21 dysfunction .

Clinical and Research Implications

VMA21 mutations are associated with distinct pathologies, underscoring its importance in human health:

Disease Associations

DisorderKey FeaturesMechanismSource
X-linked MyopathyMuscle atrophy, excessive autophagy, sarcoplasmic reticulum dysfunctionDefective V₀ assembly; loss of VMA21-120
Congenital Glycosylation DefectsHepatic steatosis, hypocholesterolemia, impaired glycoprotein traffickingV-ATPase misassembly; ER stress
Colorectal CancerUpregulated expression correlates with favorable survival in early-stage diseaseTumor suppressor role; inhibits cell proliferation

Functional Studies

  • V-ATPase Assembly: VMA21 deficiency in yeast and human cells disrupts V₀ subunit stability and proton pump activity .

  • Lysosomal Dysfunction: Impaired acidification leads to lipid droplet accumulation and autolysosome enlargement .

  • Muscle-Specific Role: VMA21-120 is upregulated during myogenesis and regeneration, critical for sarcoplasmic reticulum function .

Therapeutic Potential

  • Cancer Research: Overexpression of VMA21 suppresses colorectal cancer cell colony formation and tumor growth in xenograft models .

  • Liver Disease: Targeting VMA21 may address steatosis by modulating cholesterol synthesis and lipophagy .

Genetic and Proteomic Data

ParameterDetailsSource
Gene IDENSG00000160131 (ENST00000330374.7 canonical transcript)
MutationsPathogenic variants (e.g., p.Arg18Gly, p.Asp63Gly) linked to CDG and XMEA
ExpressionElevated in CRC tissues; muscle-specific isoform induced during differentiation

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
VMA21; MEAX; XMEA; Vacuolar ATPase assembly integral membrane protein VMA21; Myopathy with excessive autophagy protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
VMA21
Target Protein Sequence
MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMS NRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Gene References Into Functions
  1. A Japanese family afflicted by X-linked myopathy with excessive autophagy exhibited high urinary beta2 microglobulin without renal dysfunction. Decreased urine acidification in the distal convoluted tubules may be attributed to a VMA21 gene mutation. PMID: 23850239
  2. This study demonstrated that LOC203547 is the human ortholog of Vma21p. Hypomorphic mutations in the VMA21 gene disrupt autophagy and cause X-linked Myopathy with Excessive Autophagy. PMID: 23315026
Database Links

HGNC: 22082

OMIM: 300913

KEGG: hsa:203547

STRING: 9606.ENSP00000333255

UniGene: Hs.58633

Involvement In Disease
Myopathy, X-linked, with excessive autophagy (MEAX)
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

How many isoforms of VMA21 exist and what are their tissue distribution patterns?

Research has identified multiple VMA21 isoforms with distinct tissue expression patterns:

  • VMA21-101: This isoform is ubiquitously expressed across tissues, with highest levels detected in liver, brain, and lung .

  • VMA21-120: This is a muscle-specific isoform predominantly expressed in skeletal muscles (tibialis anterior, gastrocnemius, soleus, and diaphragm) with intermediate expression in the heart .

  • VMA21-134: This isoform has been detected in brain, kidney, lung, and diaphragm but is barely detectable in other tissues .

The expression pattern varies significantly between muscle and non-muscle tissues. When normalized to total VMA21 expression, VMA21-101 expression is highest in non-muscle tissues, while VMA21-120 expression is predominantly detected in skeletal muscles and diaphragm, with intermediate expression in the heart .

How does VMA21 expression change during myogenesis?

During myogenic differentiation, total VMA21 mRNA levels significantly increase, primarily driven by a striking up-regulation of the VMA21-120 isoform. This coincides with the upregulation of Myog, which encodes the myogenic differentiation marker Myogenin . In contrast, VMA21-101 levels remain largely unchanged during differentiation. This pattern suggests that the muscle-specific isoform VMA21-120 plays a specialized role in muscle development and function, which may explain why mutations in VMA21 can lead to muscle-specific pathologies like X-linked myopathy with excessive autophagy (XMEA) .

What expression systems are most effective for producing recombinant human VMA21?

For recombinant human VMA21 expression, mammalian expression systems like HEK293T cells have been successfully used in research contexts . When expressing recombinant VMA21 variants (including wild-type and mutant forms such as VMA21 R18G, VMA21 D63G, and VMA21 G91A), comparable expression levels can be achieved through transient transfection with appropriate vectors containing Myc-tags or other epitope tags to facilitate detection and purification .

For functional studies, recombinant VMA21 can also be expressed in yeast systems through homologous recombination into the yeast genomic locus, which allows for functional complementation assays to assess V-ATPase activity in the presence of various VMA21 mutations .

What are the methodological challenges in working with recombinant VMA21?

As an integral membrane protein, VMA21 presents several challenges for recombinant expression and purification:

  • Protein solubility: Given its membrane-embedded nature, VMA21 requires appropriate detergents or membrane-mimetic systems for solubilization and purification.

  • Maintaining proper folding: The presence of multiple transmembrane domains makes it challenging to ensure that recombinant VMA21 adopts its native conformation during expression and purification.

  • Isoform-specific expression: When studying specific isoforms like the muscle-specific VMA21-120, specialized expression systems may be required to achieve proper post-translational modifications and folding .

  • Functional assessment: Unlike soluble proteins, functional assays for VMA21 often require reconstitution into membrane systems or utilization of indirect assays that measure V-ATPase assembly or activity, such as the yeast growth assay in elevated zinc conditions .

What are the established methods to assess V-ATPase assembly and function in the context of VMA21 research?

Several complementary approaches can be used to assess V-ATPase assembly and function:

  • Western blot analysis of V0 and V1 domain subunits: This allows assessment of steady-state levels of V-ATPase components. While V1 subunits (ATP6V1D1 and ATP6V1B1/2) typically remain unaffected by VMA21 mutations, V0 subunits (ATP6V0D1 and ATP6V0C) show reduced expression, indicating impaired V0 assembly in the ER .

  • Co-immunoprecipitation assays: These can be used to evaluate interactions between VMA21 and V-ATPase components or assembly factors like ATP6AP2. Mutations in VMA21 can reduce these interactions, interfering with proper assembly of the V-ATPase .

  • Yeast complementation assay: This functional assay leverages the dependence of yeast V-ATPase activity for survival and growth in the presence of elevated divalent cations, such as zinc. Wild-type human VMA21 can rescue yeast growth under elevated zinc conditions, while pathogenic variants impair this rescue capacity .

  • Lysosomal acidification assessment: Fluorescent dyes like LysoSensor and LysoTracker can be used to evaluate lysosomal acidification in patient-derived or VMA21-deficient cells. Reduced number and intensity of LysoSensor or LysoTracker-positive punctae indicate impaired V-ATPase function .

How can researchers effectively study the different isoforms of VMA21?

To study different VMA21 isoforms, researchers can employ several approaches:

  • Isoform-specific PCR: Design primers that specifically target unique regions of each isoform. This allows quantification of isoform-specific expression patterns across tissues .

  • Quantitative PCR (qPCR): This can be used to measure total VMA21 mRNA levels and the relative abundance of each isoform when normalized to total expression .

  • Isoform-specific antibodies: Antibodies against VMA21-101 or VMA21-120 can be used to confirm tissue expression patterns at the protein level through western blotting .

  • Myogenic differentiation models: C2C12 myoblast differentiation systems can be particularly useful for studying the regulation of VMA21 isoforms during muscle development, as they show distinct expression patterns during differentiation .

  • Tissue panel analysis: Analyzing expression across multiple tissues (liver, brain, kidney, lung, various skeletal muscles, and heart) provides valuable insights into the tissue-specific functions of different isoforms .

What functional assays can be used to study the impact of VMA21 mutations?

Several functional assays have been established to study the impact of VMA21 mutations:

  • mRNA stability assessment: Quantitative PCR can reveal whether mutations affect mRNA stability. For instance, CDG-associated VMA21 mutations show strongly reduced mRNA levels, suggesting mRNA instability .

  • Protein expression analysis: Western blotting can determine if mutations affect protein expression levels. Both CDG and XMEA mutations reduce VMA21 protein levels to varying degrees .

  • V-ATPase assembly assessment: Analysis of V0 and V1 domain components can reveal assembly defects. VMA21 mutations typically reduce expression of V0 subunits without affecting V1 subunits .

  • Protein interaction studies: Co-immunoprecipitation assays can determine if mutations affect interactions with other proteins, such as ATP6AP2 and V0 subunit ATP6V0C .

  • Yeast functional complementation: This assay tests whether mutant VMA21 can rescue growth defects in yeast under conditions requiring V-ATPase activity .

  • Lysosomal acidification: LysoSensor and LysoTracker assays in patient fibroblasts can assess the functional impact of mutations on lysosomal pH regulation .

How do VMA21 mutations lead to tissue-specific pathologies despite its ubiquitous expression?

The tissue-specific pathologies observed in VMA21 mutations can be explained by several factors:

  • Isoform-specific effects: The discovery of tissue-specific VMA21 isoforms provides an important insight into clinical diversity. XMEA-associated mutations lead to both VMA21-101 deficiency and loss of VMA21-120 expression, which may explain the predominant muscle involvement .

  • Tissue-dependent requirements: Different tissues may have varying dependencies on V-ATPase function. Skeletal muscle and liver might be particularly sensitive to impairments in lysosomal acidification due to their high metabolic activity and reliance on autophagy for homeostasis.

  • Mutation-specific effects: Different mutations in VMA21 lead to distinct clinical presentations. Mutations associated with XMEA primarily affect muscle, while those causing CDG affect liver function. These mutations may differentially impact VMA21 function in a tissue-specific manner .

  • Compensatory mechanisms: Some tissues may have compensatory mechanisms that can partially offset VMA21 deficiency, leading to variable disease manifestations across different tissues.

What is the relationship between VMA21 deficiency and lipid metabolism disorders?

VMA21 deficiency has significant impacts on lipid metabolism through several interconnected mechanisms:

  • Impaired lipophagy: Defective V-ATPase assembly due to VMA21 mutations leads to impaired lysosomal acidification and degradation of phagocytosed materials, causing lipid droplet accumulation in autolysosomes .

  • ER stress activation: VMA21 deficiency triggers endoplasmic reticulum stress and sequestration of unesterified cholesterol in lysosomes .

  • Cholesterol synthesis upregulation: The sequestration of cholesterol activates sterol response element-binding protein (SREBP)-mediated cholesterol synthesis pathways, leading to increased cholesterol production .

  • Clinical manifestations: These molecular defects manifest as hypercholesterolemia with increased LDL cholesterol and hepatic steatosis, resembling non-alcoholic fatty liver disease (NAFLD) .

  • Tissue specificity: While these mechanisms potentially affect all tissues, the liver is particularly susceptible due to its central role in lipid metabolism, explaining the predominant hepatic involvement in VMA21-CDG patients .

How do the pathophysiological mechanisms differ between VMA21-associated XMEA and CDG?

The pathophysiological mechanisms show both similarities and differences between VMA21-associated XMEA and CDG:

FeatureVMA21-XMEAVMA21-CDG
Primary tissue affectedSkeletal muscleLiver
Clinical presentationProgressive vacuolization and atrophy of skeletal muscleMild cholestasis, chronic hypertransaminasemia, hyperlipidemia, hepatic steatosis
Glycosylation abnormalitiesNormal glycosylation profilesAbnormal glycosylation of hepatocyte-derived proteins
VMA21 protein expressionMild to moderate reductionStrong reduction (especially in c.10C>T and p.Arg18Gly mutations)
mRNA stabilitySlightly reducedStrongly reduced
V-ATPase assemblyImpairedImpaired
Lysosomal acidificationReducedReduced
AutophagyExcessive autophagy in muscleImpaired autophagy and lipophagy in liver

Both conditions share the fundamental defect in V-ATPase assembly and function but manifest differently due to tissue-specific effects and potentially differing severity of functional impairment .

What are the potential therapeutic approaches for VMA21-related disorders?

Several potential therapeutic approaches could be considered for VMA21-related disorders:

  • Gene therapy approaches: Delivering functional VMA21 gene to affected tissues could potentially restore V-ATPase assembly and function. This would need to be tailored to the specific tissues affected (muscle for XMEA, liver for CDG).

  • Pharmacological chaperones: Small molecules that could stabilize mutant VMA21 proteins might improve their folding, trafficking, and function, potentially rescuing V-ATPase assembly.

  • Autophagy modulators: Since defective autophagy is a key feature in both XMEA (excessive autophagy) and CDG (impaired lipophagy), drugs that modulate autophagy in tissue-specific ways might alleviate disease symptoms.

  • Targeting lipid metabolism: For VMA21-CDG patients with hepatic steatosis and hypercholesterolemia, interventions targeting lipid metabolism pathways could potentially mitigate these symptoms, particularly by addressing the SREBP-mediated cholesterol synthesis upregulation .

  • Lysosomal pH modulation: Approaches to artificially modulate lysosomal pH in VMA21-deficient cells might partially compensate for the V-ATPase dysfunction.

How might differential expression of VMA21 isoforms during development impact disease progression?

The differential expression of VMA21 isoforms during development may significantly impact disease progression in several ways:

  • Developmental timing: The striking up-regulation of VMA21-120 during myogenic differentiation suggests a critical role in muscle development . Consequently, mutations affecting this isoform might manifest at specific developmental stages or progressively worsen as muscle development and turnover continue.

  • Tissue-specific vulnerabilities: The predominant expression of VMA21-120 in skeletal muscles creates a tissue-specific vulnerability, explaining why XMEA primarily affects muscle despite VMA21 being expressed ubiquitously through the VMA21-101 isoform .

  • Disease onset variability: XMEA can present with variable age of onset, from a prenatal/neonatal severe phenotype to a milder course with onset after age 5 . This variability might relate to the temporal expression patterns of different VMA21 isoforms during development.

  • Potential for compensatory mechanisms: The existence of multiple isoforms raises the possibility that upregulation of one isoform might partially compensate for deficiency in another, potentially explaining some of the variability in disease severity and progression.

What are the most pressing methodological challenges in studying the molecular pathways downstream of VMA21 deficiency?

Several methodological challenges exist in studying downstream pathways affected by VMA21 deficiency:

  • Distinguishing primary from secondary effects: Since V-ATPase dysfunction affects multiple cellular processes, it is challenging to distinguish direct consequences of VMA21 deficiency from secondary adaptations.

  • Tissue-specific analyses: Given the tissue-specific expression of VMA21 isoforms and pathology, developing appropriate tissue-specific models that accurately recapitulate the disease is crucial but technically challenging.

  • Temporal dynamics: Understanding how V-ATPase dysfunction progressively affects cellular homeostasis over time requires sophisticated time-course experiments and longitudinal studies.

  • Integration of multiple pathways: VMA21 deficiency affects multiple interconnected pathways including lysosomal function, autophagy, lipid metabolism, and ER stress. Integrating these complex interactions into a coherent model requires sophisticated systems biology approaches.

  • Translating between model systems: Findings from yeast or cell culture models need to be carefully validated in more physiologically relevant systems, including patient-derived cells or tissue-specific organoids, to ensure relevance to human disease .

  • Quantitative assessment of V-ATPase assembly and function: Developing more quantitative and high-throughput methods to assess V-ATPase assembly and function would significantly advance the field beyond the current semi-quantitative approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.