Recombinant Human Vang-like protein 2 (VANGL2)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Structure

VANGL2 is a transmembrane protein that plays a fundamental role in the planar cell polarity pathway, which coordinates the orientation of cells within epithelial tissues. Structural studies have revealed that VANGL2 exists as a complex oligomer, primarily forming hexamers with D3 symmetry. These hexamers consist of dimers of trimers, with the two trimers directly facing each other through their cytoplasmic portions, creating a rod-like structure approximately 210 Å in length . The transmembrane regions are positioned on the lateral sides of this hexameric complex, while the N-terminal regions preceding the transmembrane domain exhibit flexibility and do not participate in the core structure .

Isoforms and Variants

A significant discovery in VANGL2 research is the identification of an N-terminally extended isoform called VANGL2-Long. This isoform arises from alternative translation initiation at a near-cognate AUA start codon upstream of the coding region of canonical VANGL2 . The N-terminal extension is strongly conserved across vertebrate genomes, suggesting evolutionary importance . When detected by Western blot, canonical VANGL2 appears at approximately 62 kDa, while VANGL2-Long presents as a weaker band at approximately 70 kDa .

Role in Planar Cell Polarity

VANGL2 is a core component of the planar cell polarity pathway, which is essential for coordinating cell polarity across tissue planes. Research has demonstrated that both VANGL2 and VANGL2-Long are required for the polarized distribution of other PCP molecules such as Pk2 and Dvl1 . The protein contributes significantly to the pool of VANGL2 molecules present at the plasma membrane, which is necessary to maintain PCP in vertebrate tissues .

Protein Interactions

VANGL2 forms multimeric complexes with its paralog VANGL1, indicating cooperative functions in the PCP pathway. Studies have confirmed physical interaction between VANGL1 and VANGL2 through co-immunoprecipitation experiments . Similarly, VANGL2-Long can hetero-oligomerize with VANGL1 independently of the presence of endogenous VANGL2, suggesting functional redundancy or complementation between these proteins . Recent structural studies have also revealed the molecular details of VANGL-PRICKLE interactions, providing insights into their functional connections in the PCP pathway .

Neural Development

VANGL2 plays crucial roles in neural development, particularly in neurulation and neuronal migration. In zebrafish models, VANGL2 is essential for the migration of Islet1-expressing facial branchiomotor (FBM) neurons from rhombomere 4 to rhombomere 6 during hindbrain development . Loss of VANGL2 function results in complete failure of these neurons to exit rhombomere 4, demonstrating its critical role in neuronal migration .

Convergent Extension

VANGL2 is critical for convergent extension, a morphogenetic process where tissues narrow along one axis while elongating along a perpendicular axis. This process is clinically relevant to the etiology of neural tube defects and other lumbosacral malformations . Functional analysis of VANGL2 variants has revealed differential effects on convergent extension, with some variants retaining wild-type activity and others showing partial or complete loss of function .

Cardiovascular Development

Independent of its role in laterality determination, VANGL2 is essential for proper cardiovascular development. Loss of VANGL2 in mice results in a spectrum of cardiovascular malformations, and similar defects are observed in zebrafish models . Specifically, VANGL2 is involved in heart jogging (the initial asymmetric displacement of the heart tube) and heart tube formation, with loss of function resulting in cardia bifida (formation of two separate heart tubes) .

Antibodies and Detection

Commercial antibodies are available for the detection of VANGL2 in research applications. For example, sheep anti-human/mouse/rat VANGL2 antigen affinity-purified polyclonal antibodies have been developed to target recombinant human VANGL2 (Gln241-Val521) . These antibodies can be used in Western blot analysis of mouse kidney, human and rat brain tissue, where they detect VANGL2 at approximately 65 kDa .

Immunohistochemistry Applications

VANGL2 expression patterns can be visualized in tissue sections using immunohistochemistry. In mouse embryos (E15.5), VANGL2 staining is localized specifically to the developing spinal cord, consistent with its role in neural development . This technique typically involves overnight incubation with primary antibodies at 4°C, followed by staining with secondary antibody detection systems .

Rescue Experiments

Functional analysis of VANGL2 variants has been conducted using rescue experiments in animal models. In zebrafish with homozygous vangl2 mutations, injection of wild-type human VANGL2 mRNA can partially rescue phenotypes such as convergent extension defects, abnormal heart jogging, and cardia bifida . This experimental approach allows assessment of the functional consequences of VANGL2 variants identified in human populations.

Variant Effects on Convergent Extension

Studies have categorized VANGL2 variants based on their ability to rescue convergent extension in zebrafish models. Some variants (p.Leu242Val, p.Arg135Trp, p.Arg105Cys, p.Ser84Phe, and p.Arg270His) demonstrate function comparable to wild-type VANGL2, while others (p.Arg169His, p.Thr247Met, and p.Arg353Cys) show partial function . Some variants (p.Arg177His and p.Val178Ile) exhibit no functional activity related to convergent extension, and surprisingly, variants localized to the C-terminus (p.Phe437Ser, p.Glu465Ala, and p.Arg482His) actually worsen the convergent extension phenotype compared to untreated mutants .

Effects on Neuronal Migration

VANGL2 variants also differ in their ability to rescue neuronal migration defects. Only three variants (p.Arg353Cys, p.Arg270His, and p.Thr274Met) produce neuronal migration comparable to that achieved with wild-type VANGL2 mRNA . This differential effect on various developmental processes highlights the complex structure-function relationships within the VANGL2 protein.

Expression and Conservation

The recently identified VANGL2-Long isoform is expressed during embryogenesis alongside the canonical shorter isoform in Xenopus laevis . The sequence encoding the N-terminal extension is strongly conserved among vertebrate genomes, suggesting functional importance across species . This conservation implies selective pressure to maintain this alternative translational start site throughout vertebrate evolution.

Functional Significance

Specific knockdown of VANGL2-Long using morpholino oligonucleotides in Xenopus causes typical PCP phenotypes, including neural tube closure defects and centriole rotational polarity defects in multiciliated cells . These experiments demonstrate that VANGL2-Long is functionally required for embryo extension and neural tube closure, key developmental processes dependent on planar cell polarity .

Molecular Function

Both VANGL2 and VANGL2-Long are required for the polarized distribution of PCP molecules Pk2 and Dvl1 and for centriole rotational polarity in ciliated epidermal cells . This indicates that VANGL2-Long makes significant contributions to the pool of VANGL2 molecules present at the plasma membrane that are necessary to maintain PCP in vertebrate tissues .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development based on your preference.
Synonyms
VANGL2; KIAA1215; STB1; Vang-like protein 2; Loop-tail protein 1 homolog; Strabismus 1; Van Gogh-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MDTESQYSGYSYKSGHSRSSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTR GDERDDNWGETTTVVTGTSEHSISHDDLTRIAKDMEDSVPLDCSRHLGVAAGATLALLSF LTPLAFLLLPPLLWREELEPCGTACEGLFISVAFKLLILLLGSWALFFRRPKASLPRVFV LRALLMVLVFLLVVSYWLFYGVRILDARERSYQGVVQFAVSLVDALLFVHYLAVVLLELR QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAK KVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRVRKRRARLV VAVEEAFTHIKRLQEEEQKNPREVMDPREAAQAIFASMARAMQKYLRTTKQQPYHTMESI LQHLEFCITHDMTPKAFLERYLAAGPTIQYHKERWLAKQWTLVSEEPVTNGLKDGIVFLL KRQDFSLVVSTKKVPFFKLSEEFVDPKSHKFVMRLQSETSV
Uniprot No.

Target Background

Function
VANGL2 is involved in the regulation of early morphogenesis and patterning of both axial midline structures and the development of the neural plate. It plays a role in regulating planar cell polarity, particularly in the orientation of stereociliary bundles in the cochlea. VANGL2 is required for the polarization and movement of myocardializing cells in the outflow tract and appears to act via RHOA signaling to regulate this process. It is also essential for the cell surface localization of FZD3 and FZD6 in the inner ear.
Gene References Into Functions
  1. VANGL2 interacts with Integrin alphaVbeta3 to regulate matrix metalloproteinase activity and cell adhesion to the extracellular matrix. PMID: 29097183
  2. Experimental data suggests that high expression of Prickle1 and Vangl2 reduces the growth of neuroblastoma cells, highlighting their distinct roles in tumorigenic cells compared to normal cells. PMID: 27036398
  3. VANGL2 is overexpressed in basal breast cancers and is implicated in the proliferative signal cascade of the VANGL2-SQSTM1-JNK pathway. PMID: 26754771
  4. Research suggests that Arfrp1 exposes a binding site on AP-1, enabling recognition of the Vangl2 sorting motif for capture into a transport vesicle destined for the proximal surface of a polarized epithelial cell. PMID: 23326640
  5. Aberrant VANGL2 promoter methylation and decreased gene expression are associated with Tetralogy of Fallot. PMID: 25200836
  6. VANGL2 asymmetry in migrating lymphocytes can serve as a tool to monitor the activity of the mammalian WNT/planar cell polarity pathway. PMID: 25627785
  7. Mutations in residues R181 and R274 play crucial roles in Vangl protein function, leading to neural tube defects in humans. PMID: 25068569
  8. Van-Gogh-like 2 is frequently methylated in MSI-CRCs with BRAF mutation and may function as a tumor suppressor gene, counteracting WNT/beta-catenin signaling. PMID: 23579212
  9. Findings strongly suggest VANGL2 involvement in the genetic causation of spinal NTDs in a subset of patients, further supporting the pathogenic role of PCP signaling in these malformations. PMID: 20738329
  10. Loss of membrane targeting of Vangl1 and Vangl2 proteins results in neural tube defects. PMID: 21142127
  11. The planar cell polarity genes Celsr1 and Vangl2 are essential for normal lung branching morphogenesis. PMID: 20223754
  12. Three novel missense mutations in fetuses with neural-tube defects were identified. PMID: 20558380
  13. Van Gogh-Like 2 regulates tumor cell migration and matrix metalloproteinase-dependent invasion. PMID: 19577357
  14. Results indicate that there is no specific mutation responsible for the Tetralogy of Fallot phenotype in the Vangl2 gene. PMID: 18034999

Show More

Hide All

Database Links

HGNC: 15511

OMIM: 182940

KEGG: hsa:57216

STRING: 9606.ENSP00000357040

UniGene: Hs.99477

Involvement In Disease
Neural tube defects (NTD)
Protein Families
Vang family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is VANGL2 and what are its primary functions in cellular biology?

VANGL2 (Vang-like protein 2) is a core component of the planar cell polarity (PCP) pathway that regulates tissue polarity and patterning. VANGL2 functions primarily in establishing cellular asymmetry across a tissue plane, which is essential for proper morphogenesis during development. The protein contains multiple transmembrane domains and is localized to the plasma membrane where it participates in cell-cell communication to coordinate polarized cell behaviors . VANGL2 plays critical roles in various developmental processes including neural tube closure, lung branching morphogenesis, and mammary gland development . At the molecular level, VANGL2 regulates cytoskeletal organization, particularly actomyosin networks, that are crucial for generating mechanical forces during morphogenesis .

How is VANGL2 structurally organized and what are its key domains?

VANGL2 is a multi-pass transmembrane protein with intracellular N- and C-terminal domains. The protein contains four transmembrane domains with both N- and C-termini facing the cytoplasm. The C-terminal cytoplasmic domain contains a PDZ-binding motif that mediates interactions with other PCP proteins. Structurally important regions include phosphorylation sites in the cytoplasmic domains that are crucial for VANGL2 function . The protein's structure enables it to form complexes with other PCP components, including Frizzled receptors and Dishevelled proteins, to establish asymmetric protein localization across cell boundaries . Molecular weight analysis by Western blot typically shows VANGL2 at approximately 65 kDa .

What experimental systems are commonly used to study VANGL2 function?

Researchers typically employ several model systems to study VANGL2 function:

  • Mouse models: The Looptail (Lp) mouse carrying the S464N missense mutation in VANGL2 is a widely used model that exhibits neural tube defects and other developmental abnormalities .

  • Conditional knockout systems: Tissue-specific VANGL2 deletion using Cre-lox systems (e.g., MMTV-Cre;Vangl2flox/flox) allows investigation of VANGL2 function in specific tissues like mammary glands .

  • Cell culture systems: Primary cells or established cell lines with VANGL2 knockdown or overexpression are used to study cellular mechanisms .

  • Recombinant protein expression: E. coli-derived recombinant human VANGL2 fragments (e.g., Gln241-Val521) are used for antibody production and biochemical studies .

  • Organoid cultures: Mammary cysts and other 3D culture systems help examine VANGL2's role in epithelial organization .

These experimental systems enable researchers to investigate VANGL2's functions at multiple scales from molecular interactions to tissue-level organization.

What is the Looptail (Lp) mutation in VANGL2 and how does it affect protein function?

The Looptail (Lp) mutation in VANGL2 is a missense mutation (S464N) that significantly impairs protein function. This mutation has several critical consequences:

  • Trafficking defects: The Lp mutation impairs transport of VANGL2 from the endoplasmic reticulum to the Golgi apparatus and ultimately to the plasma membrane .

  • Dominant negative effects: Importantly, Lp VANGL2 not only fails to reach the membrane itself but also blocks wild-type VANGL2 protein trafficking, resulting in a dominant negative effect .

  • Developmental consequences: Homozygous Lp/Lp mice display severe neural tube defects (craniorachischisis), demonstrating the essential role of VANGL2 in neurulation .

  • Molecular mechanism: Unlike phosphorylation-deficient VANGL2 mutants that trigger endocytosis of binding partners, the Lp mutant retains wild-type VANGL2 in the endoplasmic reticulum, preventing its proper localization .

The Lp mutation has been instrumental in understanding VANGL2 function, as it demonstrates how membrane localization is critical for VANGL2's role in planar cell polarity signaling and developmental processes.

What VANGL2 isoforms exist and how do their functions differ?

Recent research has identified alternative VANGL2 isoforms that expand our understanding of this protein's functional diversity:

  • VANGL2-Long: A translational variant of VANGL2 has been identified that is derived from an alternative translation start site. This VANGL2-Long isoform is approximately 569 amino acids in length compared to the canonical VANGL2 .

  • Functional significance: VANGL2-Long appears to contribute significantly to the pool of VANGL2 molecules present at the plasma membrane and is required for maintaining planar cell polarity in vertebrate systems .

  • Expression patterns: Different VANGL2 isoforms may show distinct tissue expression patterns and developmental timing, suggesting specialized functions in different contexts.

  • Structural differences: The VANGL2-Long isoform contains additional N-terminal sequences that may mediate unique protein-protein interactions or modify membrane localization properties .

Understanding these isoforms is crucial as they may have distinct contributions to development and disease, potentially explaining tissue-specific phenotypes observed in VANGL2 mutants.

How do VANGL1 and VANGL2 functionally relate and what is their redundancy in vertebrates?

VANGL1 and VANGL2 are mammalian homologs of the Drosophila Vang/Strabismus protein, and their relationship demonstrates both redundancy and specificity:

  • Functional redundancy: VANGL1 and VANGL2 function redundantly in many aspects of planar cell polarity and together regulate mammalian morphogenesis in a dose-dependent manner .

  • Developmental requirements: While both proteins contribute to PCP, VANGL2 mutations typically produce more severe phenotypes than VANGL1 mutations, suggesting a more prominent role for VANGL2 in certain developmental contexts .

  • Expression patterns: The proteins show partially overlapping but distinct expression patterns across tissues and developmental stages, which may explain tissue-specific phenotypes when either gene is mutated.

  • Genetic interactions: Studies have shown that combined heterozygosity for mutations in both VANGL1 and VANGL2 can produce phenotypes not seen in single heterozygotes, demonstrating their cooperative functions .

  • Evolutionary conservation: Both proteins show high conservation across vertebrate species, indicating their fundamental importance in development.

This functional relationship explains why certain tissues may be more sensitive to VANGL2 deficiency while others show compensation by VANGL1, an important consideration when designing tissue-specific studies.

How does VANGL2 regulate neural tube closure and what are the consequences of its dysfunction?

VANGL2 plays a critical role in neural tube closure through several mechanisms:

  • Convergent extension: VANGL2 mediates the polarized cell movements required for convergent extension, the process by which the neural plate narrows and elongates during neurulation .

  • Cellular organization: VANGL2 regulates the polarized organization of neuroepithelial cells, essential for neural plate bending and closure .

  • Cytoskeletal regulation: VANGL2 modulates actomyosin contractility, which generates forces necessary for tissue morphogenesis during neural tube closure .

  • Phosphorylation-dependent function: Vangl2 phosphorylation, induced by Wnt5a signaling, is required for proper VANGL2 function during neural tube closure in a dose-dependent manner .

The consequences of VANGL2 dysfunction in neural tube development include:

  • Neural tube defects: Both Vangl2 Lp/Lp mice and mice expressing phospho-mutant Vangl2 exhibit open neural tube defects, demonstrating the crucial role of VANGL2 function and phosphorylation .

  • Human pathologies: Mutations in VANGL2 phosphorylation sites have been identified in human patients with neural tube defects, highlighting the clinical relevance of VANGL2 function .

  • Cellular anomalies: VANGL2 dysfunction leads to abnormal cell polarity, disrupted intercellular junctions, and impaired tissue biomechanics that collectively prevent proper neural fold elevation and fusion .

These findings underscore the essential role of VANGL2 in coordinating the complex cellular behaviors required for neural tube morphogenesis.

What role does VANGL2 play in mammary gland development and organization?

VANGL2 has been shown to significantly influence mammary gland development and organization through several mechanisms:

  • Ductal morphogenesis: VANGL2 regulates mammary ductal outgrowth and branching. Vangl2Lp/Lp tissue exhibits deficient outgrowth when transplanted, indicating VANGL2's requirement for proper ductal development .

  • Lumen formation: In MMTV-Cre;Vangl2Lp/Lp glands, lumens are narrowed and cell turnover is reduced, suggesting VANGL2's role in lumen formation and maintenance .

  • Tissue-specific effects: VANGL2 exhibits differential effects in the basal versus luminal compartments of the mammary epithelium. Loss of VANGL2 in the basal compartment inhibits cyst formation, while loss in the luminal compartment has the opposite effect, enhancing cyst formation .

  • Morphological abnormalities: Successful Vangl2Lp/Lp outgrowths display three characteristic phenotypes: distended ducts, supernumerary end buds, and ectopic acini, revealing VANGL2's multifaceted roles in mammary morphogenesis .

  • Gene expression regulation: VANGL2 influences the expression of genes important for mammary development, including Bmi1, with overexpression of Bmi1 rescuing defects in VANGL2 knockdown mammary cysts .

These findings highlight VANGL2's complex role in coordinating mammary epithelial organization through effects on both tissue architecture and gene expression programs.

How does VANGL2 contribute to lung branching morphogenesis?

VANGL2 plays a crucial role in lung branching morphogenesis through several mechanisms:

  • Airway organization: The VANGL2 Looptail mutation causes narrow or collapsed airway lumens, indicating VANGL2's importance in establishing proper airway architecture .

  • Mechanosignaling regulation: VANGL2 regulates traction force generation and mechanosignaling, which are essential processes for branching morphogenesis .

  • YAP/TAZ pathway modulation: VANGL2 deficiency is associated with reduced nuclear (active) YAP and increased cytoplasmic phospho-YAP (inactive) in lung epithelium. Since YAP serves as a readout of mechanosignaling activity, this indicates VANGL2's active role in mechanotransduction during lung development .

  • Focal adhesion regulation: VANGL2 regulates focal adhesion size and density, affecting how lung epithelial cells sense and respond to mechanical cues crucial for branch patterning .

  • Actomyosin organization: VANGL2 is required for the formation of optimal actomyosin networks that drive traction force generation, with Vangl2Lp/+ cells showing defects in actomyosin contractility and mechanical force transmission .

These findings demonstrate that VANGL2 is an essential regulator of the mechanical processes that drive lung morphogenesis, linking planar cell polarity signaling to the physical forces required for proper tissue patterning.

How does VANGL2 phosphorylation regulate its function in planar cell polarity?

VANGL2 phosphorylation serves as a critical regulatory mechanism for its function in planar cell polarity:

  • Wnt5a-induced phosphorylation: Vangl2 phosphorylation is induced by Wnt5a signaling, representing a key molecular event in PCP pathway activation .

  • Dose-dependent requirement: The level of Vangl2 phosphorylation quantitatively affects its function, with phosphorylation levels modulating Vangl2 "activity" in a dose-dependent manner .

  • Phospho-mutant effects: Phospho-mutant Vangl2 fails to exhibit the polarized localization seen with wild-type Vangl2 and instead distributes in small puncta, demonstrating that phosphorylation is required for proper membrane localization .

  • Dominant negative mechanism: Phospho-mutant Vangl2 exerts dominant negative effects by triggering endocytosis of its binding partners and by "hijacking" wild-type endogenous Vangl2 protein, thereby disrupting normal PCP signaling .

  • Clinical relevance: Vangl1 and Vangl2 phosphorylation sites have been found mutated in human patients with neural tube defects, highlighting the pathological significance of this regulatory mechanism .

These findings establish VANGL2 phosphorylation as a molecular switch that controls protein localization, activity, and ultimately planar cell polarity signaling during development.

What is the relationship between VANGL2 and RhoA signaling in mechanotransduction?

VANGL2 and RhoA signaling are intricately connected in mechanotransduction processes:

  • Actomyosin contractility regulation: VANGL2 regulates actomyosin contractility via its effector RhoA. VANGL2-deficient cells show reduced MLC2 phosphorylation, indicating decreased RhoA-ROCK-dependent actomyosin activation .

  • Rescue experiments: Addition of a Rho activator restores MLC2 activation and actomyosin organization in VANGL2-deficient cells, confirming that VANGL2 functions upstream of RhoA in this signaling pathway .

  • Traction force generation: VANGL2 regulation of RhoA activity is essential for cells to generate appropriate traction forces through focal adhesions. This represents a direct role for VANGL2, a core PCP component, in force generation .

  • Mechanosensing pathway: VANGL2 influences mechanosensing by regulating focal adhesion (FA) size and density, which affects how cells apply force generated by actomyosin-mediated contractility .

  • Downstream effectors: The RhoA-dependent pathway activated by VANGL2 ultimately influences actin cytoskeleton organization, cell contractility, and mechanical force transmission, all critical aspects of tissue morphogenesis .

This relationship between VANGL2 and RhoA signaling provides a mechanistic link between planar cell polarity and the physical forces that shape tissues during development.

How does VANGL2 interact with the YAP/TAZ mechanotransduction pathway?

VANGL2 shows significant functional interactions with the YAP/TAZ mechanotransduction pathway:

  • YAP nuclear localization: VANGL2 deficiency is associated with reduced nuclear (active) YAP and increased cytoplasmic phospho-YAP (inactive) in lung epithelium, indicating VANGL2's positive regulation of YAP activity .

  • Mechanosignaling readout: Since YAP serves as a readout of mechanosignaling activity, the altered YAP localization in VANGL2-deficient tissues provides evidence for VANGL2's active role in mechanotransduction .

  • Pathway integration: Previous studies have shown that YAP/TAZ can act as downstream effectors of the non-canonical/PCP pathway in mediating cell migration and differentiation via Frizzled and ROR receptors .

  • Developmental consequences: YAP deficiency disrupts lung branching morphogenesis in mice, paralleling the defects seen in VANGL2 mutants and suggesting a functional convergence of these pathways during development .

  • Mechanical force connection: VANGL2 regulation of traction force generation may directly influence YAP/TAZ activity, as mechanical forces are known regulators of YAP/TAZ nuclear translocation and transcriptional activity .

This interaction between VANGL2 and the YAP/TAZ pathway represents an important nexus between planar cell polarity signaling and mechanotransduction during tissue development.

What are the best methods for detecting and measuring VANGL2 protein expression and localization?

Researchers employ several complementary techniques to detect and analyze VANGL2 expression and localization:

MethodApplicationKey Considerations
Western BlotProtein expression quantificationVANGL2 typically appears at ~65 kDa; use PVDF membranes with reducing conditions for optimal results
ImmunohistochemistryTissue localization patternsFixed frozen sections work well; antibodies targeting Gln241-Val521 region show good specificity
ImmunofluorescenceSubcellular localizationCritical for assessing polarized distribution; can detect co-localization with binding partners
Recombinant protein expressionProduction of standards/antigensE. coli systems express human VANGL2 fragments (e.g., Gln241-Val521) successfully
GFP/HA-tagged constructsLive imaging of protein dynamicsHA-tagging at N-terminus preserves function for trafficking studies
Phospho-specific antibodiesAssessment of activation stateImportant for studying Wnt5a-induced phosphorylation

For optimal VANGL2 detection in experimental systems:

  • When performing immunostaining, the choice of fixation method significantly affects epitope accessibility. Paraformaldehyde fixation followed by careful permeabilization typically yields the best results for visualizing membrane-associated VANGL2.

  • For Western blotting, sample preparation should include phosphatase inhibitors if studying phosphorylation status, as VANGL2 phosphorylation is labile during processing.

  • When examining polarized distribution, high-resolution confocal microscopy with appropriate controls for membrane markers is essential to accurately assess asymmetric localization patterns.

What are effective strategies for generating and validating VANGL2 knockout or knockdown models?

Researchers employ various approaches to manipulate VANGL2 expression, each with specific advantages:

ApproachApplicationsConsiderations
Conditional knockout (flox/flox)Tissue-specific deletionAllows analysis of VANGL2 function in specific tissues while avoiding embryonic lethality
CRISPR/Cas9 genome editingGeneration of point mutationsUseful for studying specific domains or phosphorylation sites
Tissue-specific Cre linesTargeted deletionMMTV-Cre or Sox2-Cre lines enable mammary or neural tissue-specific deletion
shRNA/siRNATransient knockdownUseful for mechanistic studies in cell culture
Rosa26 locus targetingControlled expressionAllows expression of wild-type or mutant VANGL2 at physiological levels

For effective validation of these models:

  • Expression analysis: Combine qRT-PCR for mRNA levels with Western blotting for protein detection. For the Rosa26-Vangl2 system, induced wild-type VANGL2 expression is typically ~50% of endogenous levels .

  • Functional validation: Assess known VANGL2-dependent processes like polarized membrane localization, phosphorylation status, or downstream effector activation (e.g., RhoA, YAP) .

  • Phenotypic analysis: Examine tissue-specific phenotypes such as neural tube closure, lung branching, or mammary gland development to confirm functional consequences .

  • Rescue experiments: Reintroduction of wild-type VANGL2 or related molecules (e.g., Bmi1 in mammary systems) can confirm specificity of observed phenotypes .

  • Controls for dominant negative effects: When studying Vangl2Lp or phospho-mutants, include analyses of wild-type VANGL2 localization to assess potential dominant negative effects .

What experimental approaches best assess VANGL2's role in mechanotransduction?

Several specialized techniques effectively measure VANGL2's contributions to mechanotransduction:

TechniqueMeasurementInsights Provided
Traction force microscopyCell-generated forcesDirectly quantifies forces exerted by cells on substrates, revealing VANGL2's role in force generation
Focal adhesion analysisFA size and densityAssesses VANGL2's effect on mechanosensing structures; correlates with traction force magnitude
YAP/TAZ nuclear localizationMechanosignaling activationProvides readout of mechanotransduction pathway activity downstream of VANGL2
MLC2 phosphorylationActomyosin contractilityMeasures RhoA-ROCK pathway activation status influenced by VANGL2
3D organoid/cyst formationTissue morphogenesisAssesses VANGL2's role in mechanically-driven morphogenetic processes
Substrate stiffness manipulationMechanosensing responseTests how VANGL2 mediates cellular responses to different mechanical environments

For rigorous experimental design:

  • Controls: Include both wild-type and Vangl2Lp/+ or knockdown cells under identical conditions. For mechanistic studies, incorporate RhoA activators or inhibitors to establish pathway relationships .

  • Quantification methods: For traction force microscopy, use consistent substrate preparation (typically polyacrylamide gels with embedded fluorescent beads) and analyze using validated algorithms to calculate displacement fields and force vectors .

  • Focal adhesion analysis: Standardize immunostaining for FA markers (e.g., paxillin, vinculin) and employ automated image analysis to quantify size, density, and distribution parameters .

  • YAP/TAZ assessment: Quantify nuclear:cytoplasmic ratios of YAP/TAZ immunostaining and phospho-YAP levels to assess mechanotransduction pathway activation status .

  • Tissue context: Consider both 2D and 3D experimental systems, as VANGL2's mechanotransduction functions may differ between these contexts .

How do VANGL2 mutations contribute to human diseases beyond neural tube defects?

VANGL2 mutations are implicated in several human pathologies through various mechanisms:

  • Cancer progression: Alterations in VANGL2 expression have been linked to breast cancer, with high VANGL2 levels associated with the more aggressive basal type tumors and poor prognosis . The PCP pathway's role in cell migration and invasion may explain VANGL2's contributions to metastasis.

  • Congenital anomalies: Beyond neural tube defects, VANGL2 mutations may contribute to other congenital abnormalities involving disrupted morphogenesis, such as heart defects and kidney anomalies, through impaired tissue patterning and mechanical force generation .

  • Lung pathologies: VANGL2's role in lung branching morphogenesis suggests potential contributions to congenital lung diseases characterized by abnormal airway architecture .

  • Mechanobiology disorders: Given VANGL2's role in mechanotransduction, its dysfunction may contribute to disorders involving abnormal tissue biomechanics, including fibrosis and altered tissue stiffness .

  • Tissue regeneration defects: VANGL2's influence on cell polarity and coordinated cell behaviors suggests potential roles in impaired wound healing and tissue regeneration processes.

Future research should focus on comprehensive genetic screening of VANGL2 in patient cohorts with these conditions and employ tissue-specific conditional models to delineate the molecular mechanisms involved.

What is the cross-talk between VANGL2 and G-protein signaling pathways?

The intersection between VANGL2 and G-protein signaling represents an emerging area of investigation:

  • Non-canonical Wnt signaling integration: VANGL2 functions in non-canonical Wnt/PCP signaling, which shares components with G-protein coupled receptor (GPCR) pathways. Frizzled receptors, which interact with VANGL2, can signal through heterotrimeric G-proteins .

  • RhoA regulation mechanisms: VANGL2 regulates RhoA activity, which can be modulated by G-protein signaling cascades. The molecular mechanism by which VANGL2 activates RhoA may involve G-protein signaling components .

  • Nucleotide binding and GTPase activity: The mechanism of G-protein activation involves GDP/GTP exchange and GTPase activity regulated by GAPs and GEFs. Similar regulatory mechanisms may influence VANGL2-associated signaling complexes .

  • Shared downstream effectors: Both VANGL2 and G-protein pathways converge on cytoskeletal regulators and mechanotransduction components, including ROCK and myosin light chain phosphorylation .

  • Potential direct interactions: VANGL2 may interact with specific G-protein subunits or their regulators, though direct evidence for such interactions requires further investigation.

This intersection represents a promising area for future research, potentially revealing new mechanisms by which VANGL2 influences cellular behavior in development and disease.

How does VANGL2 function differentially in different cell types and developmental contexts?

VANGL2 exhibits notable context-dependent functions across diverse tissues and developmental stages:

  • Basal vs. luminal mammary compartments: VANGL2 shows opposite effects when deleted in basal versus luminal compartments of mammary epithelium. Loss in the basal compartment inhibits cyst formation, while loss in the luminal compartment enhances it, revealing cell-type specific functions .

  • Neural vs. non-neural tissues: While VANGL2 is critical for neural tube closure, its functions in other tissues like lung and mammary gland involve distinct cellular mechanisms, suggesting tissue-specific molecular partnerships .

  • Developmental timing: VANGL2's requirements may vary across developmental stages, with different thresholds of activity needed at specific morphogenetic events.

  • Compensatory mechanisms: The relative importance of VANGL1 versus VANGL2 varies between tissues, with some showing greater redundancy than others .

  • Signaling context: VANGL2 may integrate different upstream signals (Wnt5a, mechanical forces) in different cellular contexts, leading to tissue-specific outcomes .

Understanding these differential functions requires:

  • Development of more sophisticated tissue-specific and temporally controlled genetic models

  • Comprehensive interactome analyses across different cell types

  • Integration of transcriptomic, proteomic, and functional data to identify context-specific molecular mechanisms

  • Investigation of epigenetic and post-translational modifications that may confer tissue-specific functions

This context-specificity is critical for developing targeted therapeutic approaches that modulate VANGL2 function in specific diseases while minimizing effects on other tissues.

How can recombinant VANGL2 proteins be effectively produced and purified for research applications?

The production of functional recombinant VANGL2 presents specific challenges and considerations:

For researchers developing VANGL2-based reagents, these approaches provide a foundation for producing high-quality protein for structural studies, interaction analyses, and antibody development.

What are the considerations for developing therapeutic approaches targeting VANGL2 in developmental disorders?

Targeting VANGL2 for therapeutic purposes requires careful consideration of several factors:

  • Developmental timing: Since VANGL2's critical functions occur during embryonic development, interventions for congenital disorders would need to be applied prenatally, presenting significant challenges for delivery and safety.

  • Dosage sensitivity: VANGL2 function is highly dose-dependent, requiring precisely calibrated therapeutic approaches to avoid unintended consequences . Both insufficient and excessive VANGL2 activity can lead to developmental abnormalities.

  • Tissue specificity: Given VANGL2's different roles across tissues, therapeutic approaches would need to target specific tissues while sparing others to minimize side effects .

  • Molecular specificity: Distinguishing between VANGL1 and VANGL2 functions would be crucial for targeted approaches, as they show partial redundancy in some contexts .

  • Downstream pathway modulation: Rather than targeting VANGL2 directly, modulating downstream effectors like RhoA or specific phosphorylation events might provide more precise control over specific VANGL2 functions .

Potential therapeutic strategies might include:

  • Small molecules that stabilize VANGL2 membrane localization

  • Peptides that modulate specific protein-protein interactions

  • Gene therapy approaches for severe loss-of-function contexts

  • Targeted modulation of phosphorylation status

These approaches would require extensive preclinical validation in relevant model systems before clinical application.

What are the most pressing unanswered questions about VANGL2 function and regulation?

Several critical questions remain in the VANGL2 field that warrant further investigation:

  • Structural biology: What is the complete three-dimensional structure of VANGL2, including its transmembrane domains, and how does phosphorylation alter this structure?

  • Quantitative biology: How is the precise dosage of VANGL2 activity controlled in different tissues, and what are the thresholds for different developmental processes?

  • Molecular mechanisms: What is the complete phosphorylation map of VANGL2, which kinases are responsible for each site, and how do these modifications coordinate to regulate function?

  • Membrane trafficking: What molecular machinery controls VANGL2 trafficking to and from the plasma membrane in different cell types?

  • Interaction networks: What is the complete interactome of VANGL2 across different tissues and developmental stages?

  • Mechanical regulation: How does mechanical force modulate VANGL2 function, and does VANGL2 itself act as a mechanosensor?

  • Evolutionary aspects: How has VANGL2 function evolved across species, and what can this tell us about its fundamental roles?

  • Human variation: What is the full spectrum of VANGL2 variations in human populations, and how do they contribute to disease susceptibility?

Addressing these questions will require interdisciplinary approaches combining cutting-edge technologies in structural biology, quantitative imaging, proteomics, and genetic engineering.

What emerging technologies will advance our understanding of VANGL2 biology?

Several cutting-edge technologies are poised to revolutionize VANGL2 research:

  • Cryo-electron microscopy: This technique could finally reveal the complete structure of VANGL2 in different conformational states and in complex with interaction partners.

  • Single-cell multi-omics: Integrated single-cell transcriptomics, proteomics, and epigenomics will reveal cell-specific VANGL2 regulatory networks and functions.

  • Optogenetics and chemogenetics: These approaches allow precise temporal and spatial control of VANGL2 activity to dissect its acute functions independent of developmental effects.

  • Live-cell super-resolution microscopy: Advanced imaging techniques will reveal VANGL2 dynamics, trafficking, and nanoscale organization at unprecedented resolution.

  • Organoid technologies: Advanced 3D culture systems that recapitulate tissue development will provide platforms for studying VANGL2 function in human tissues.

  • Mechanobiology tools: Emerging technologies to apply and measure forces at cellular and subcellular scales will illuminate VANGL2's role in mechanotransduction.

  • In situ structural biology: Methods to visualize protein structures within cells will reveal how VANGL2 organization changes in different cellular contexts.

  • Base editing and prime editing: These precise genome editing technologies will enable subtle modifications to study specific VANGL2 variants and regulatory elements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.