Recombinant Human Vasopressin V2 receptor (AVPR2)

Shipped with Ice Packs
In Stock

Description

Recombinant AVPR2 retains the native receptor’s ability to activate Gs proteins, stimulating adenylate cyclase and increasing intracellular cAMP levels. This cascade triggers aquaporin-2 (AQP2) water channel trafficking to renal collecting duct membranes, promoting water reabsorption .

Key Functional Features:

  • Ligand Binding: AVP binds orthosteric pockets via Tyr²P–L312⁷.⁴⁰ hydrogen bonding, critical for receptor activation .

  • Disease-Associated Mutations: Over 290 AVPR2 mutations are linked to congenital NDI, classified into:

    • Type I: Impaired protein synthesis.

    • Type II: Defective cellular trafficking.

    • Type III: Functional defects (e.g., reduced cAMP response) .

Research Applications

Recombinant AVPR2 is pivotal for studying receptor pharmacology and disease mechanisms.

3.1. Functional Assays

  • cAMP Accumulation: HEK293 cells transfected with wild-type or mutant AVPR2 show dose-dependent cAMP increases upon AVP stimulation (EC₅₀: ~1 nM for WT; reduced in mutants like I177N) .

  • Localization Studies: Fluorescence tagging confirms proper membrane localization, distinguishing trafficking-defective mutants (e.g., Type II NDI) .

3.2. Therapeutic Development

  • Agonists/Antagonists: Desmopressin (a synthetic V2R agonist) is used to treat central diabetes insipidus and hemophilia A .

  • Mutation Rescue: Pharmacochaperones (e.g., SR49059) correct misfolded AVPR2 mutants in vitro .

Key Research Findings

  • Structural Insights: The AVP–V2R–Gs complex exhibits smaller TM5/6 outward shifts compared to β2-adrenergic receptors, suggesting unique activation mechanics .

  • Disease Mechanisms: Mutations like Ala165Pro destabilize TM helices, impairing membrane localization and cAMP signaling .

  • Evolutionary Adaptations: Positive selection at AVPR2 residues 190, 250, and 346 in primates correlates with water homeostasis adaptations .

Challenges and Future Directions

  • Expression Optimization: Improving recombinant AVPR2 stability for cryo-EM studies .

  • Therapeutic Targeting: Developing biased agonists to minimize off-target effects (e.g., vasoconstriction via V1 receptors) .

Product Specs

Buffer
For liquid delivery forms, the protein is stored in a Tris/PBS-based buffer containing 5%-50% glycerol. Glycerol concentration can be customized upon request; please specify your requirements when ordering.
Form
The protein is available in liquid or lyophilized powder form. While we prioritize shipping the currently available format, specific requests will be accommodated. Please indicate your preferred format during order placement.
Lead Time
Orders are typically shipped within 1-3 business days of receipt. Delivery times may vary depending on the order method and destination. Please consult your local distributor for precise delivery estimates. Shipping is standard with blue ice packs; dry ice shipping is available at an additional cost upon prior arrangement.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized powder maintains stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Synonyms
ADHR; Antidiuretic hormone receptor; Arginine vasopressin receptor 2; AVP R2; AVPR 2; AVPR V2; AVPR2; DI1; DIR 3; DIR; DIR3; MGC126533; MGC138386; NDI; Nephrogenic diabetes insipidus; Renal type arginine vasopressin receptor; Renal-type arginine vasopressin receptor; V2 receptor; V2R; V2R_HUMAN; Vasopressin V2; Vasopressin V2 receptor
Datasheet & Coa
Please contact us to get it.
Expression Region
1-371
Protein Length
Full Length
Source
in vitro E.coli expression system
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
The recombinant human vasopressin V2 receptor (AVPR2) is a G protein-coupled receptor that mediates the effects of arginine vasopressin. Its activation stimulates adenylate cyclase and plays a crucial role in renal water reabsorption.
Gene References Into Functions
AVPR2 Gene and Function: A Summary of Research Findings

Research indicates AVPR2's significant role in renal water reabsorption and its involvement in various conditions, particularly nephrogenic diabetes insipidus (NDI). The following studies highlight key findings regarding AVPR2 mutations, their phenotypic effects, and therapeutic implications:
  1. Rapid diagnostic utility of AVPR2 sequencing in newborns with familial predisposition to NDI (PMID: 29594432)
  2. Identification of a novel 22.1-kb deletion in AVPR2 causing X-linked NDI (PMID: 29394883)
  3. Overview of genetic defects in NDI and strategies for rescuing mutated AVPR2 or AQP2 activity (PMID: 29125546)
  4. Analysis of AVPR2 mutations and their differential effects on receptor trafficking (PMID: 27355191)
  5. Overview of AVPR2 mutations in genetic forms of NDI (Review, PMID: 27156763)
  6. First report of the I324M AVPR2 missense mutation in congenital NDI (PMID: 27565746)
  7. Potential of pharmacochaperones like OPC51803 as therapeutics for NDI caused by misfolded V2R mutants (PMID: 27601473)
  8. Association of AVPR2 missense mutations with NDI (PMID: 26974133)
  9. AVPR2 gene mutation as a likely cause of congenital NDI in a family (PMID: 27577218)
  10. A splice site mutation in AVPR2 leading to partial X-linked NDI (PMID: 26795631)
  11. Association of a heterozygous deletion in exon 1 of AVPR2 with NDI (PMID: 26244674)
  12. Identification and characterization of a novel gain-of-function mutation in V2R causing nephrogenic syndrome of inappropriate diuresis (NSID) (PMID: 26131744)
  13. A novel mutation at codon 137 (G137R) in AVPR2 in male dizygotic twins (PMID: 27117808)
  14. Rescue of N321K-V2R function by Val(4)-desmopressin in NDI (PMID: 24628417)
  15. X-linked NDI and illness severity caused by a novel deletion in AVPR2 (PMID: 24026507)
  16. AVP action at V2R and its role in renal water excretion during exercise (PMID: 24944242)
  17. Unexpected roles of V2R signaling and its contribution to cystic kidney epithelium (Review, PMID: 24556353)
  18. Identification of 52 disease-causing AVPR2 mutations, with missense mutations being the most prevalent (PMID: 23150186)
  19. Analysis of three AVPR2 variants associated with NSID and NDI (PMID: 23762448)
  20. Role of retromer and arrestin in non-canonical regulation of V2R signaling (PMID: 23935101)
  21. V88M mutation and its effect on V2R expression and hormone binding (PMID: 19816050)
  22. Absence of pathological variants affecting R137 in 5,142 AVPR2 alleles (PMID: 23362144)
  23. Crystal structure of beta-arrestin-1 in complex with phosphorylated V2R peptide (PMID: 23604254)
  24. Contribution of AVPR2 and AQP2 research to understanding urinary concentration mechanisms (Review, PMID: 23364801)
  25. AVPR2 mutations in patients with diabetes insipidus (PMID: 22644838)
  26. X-linked NDI and intellectual disability caused by a contiguous deletion in AVPR2 and ARHGAP4 (PMID: 22965914)
  27. Deletion mechanisms in the AVPR2 region and non-allelic homologous recombination (Review, PMID: 22879391)
  28. Retrospective analysis of 13 known AVPR2 mutations and a novel mutation in partial NDI (Review, PMID: 22386940)
  29. Loss-of-function AVPR2 mutations associated with NDI (PMID: 21917732)
  30. Association of AVPR2 SNPs with body weight loss during Ironman Triathlons (PMID: 22052024)
  31. V2R antagonists as pharmacological chaperones and inverse agonists (PMID: 22144672)
  32. Potential involvement of V2R signaling disorder in the endolymphatic sac in the pathogenesis of endolymphatic hydrops (PMID: 21574774)
  33. A novel missense mutation (L169P) in AVPR2 in a patient with inherited NDI (PMID: 22145481)
  34. Overexpression of a V2R fragment as a fusion protein (PMID: 21575724)
  35. Renal cancer cells' ability to synthesize and express V2R (PMID: 19217806)
  36. Effects of asp-lys-ile and asp-arg-tyr mutations on V2R cAMP production and cell surface expression (PMID: 20683494)
  37. The 12E-V2R variant and its association with increased levels of VWF propeptide, VWF, and FVIII (PMID: 20403097)
  38. A novel AVPR2 mutation (M311V) and its association with a milder form of NDI (PMID: 20389105)
  39. X-linked NDI caused by a novel AVPR2 mutation leading to receptor protein truncation (PMID: 19703807)
  40. Amino acid substitution in AVPR2 and its effects on surface receptor levels and cAMP production in NSID (PMID: 20159941)
  41. Absence of AVPR2 copy number variation in eunatremic and dysnatremic subjects (PMID: 19996159)
  42. Role of proteolytic cleavage of V2R in signal termination (PMID: 10561596)
  43. Identification of a novel type of contiguous gene deletion of AVPR2 in Japanese kindreds with NDI (PMID: 11754100)
  44. Isolation of a new mutation (6-AA deletion) associated with NDI (PMID: 11868598)
  45. NDI-causing mutations R106C, F287L, and R337X (PMID: 11916004)
  46. Role of a single amino acid difference in the first extracellular loop in determining cell surface expression efficiency (PMID: 11923476)
  47. Serine/threonine motif in HV2R required for cytoplasmic retention (PMID: 12482593)
  48. Enhancement of beta-arrestin recruitment to activated V2R by palmitoylation (PMID: 12900404)
  49. Regulation of V2R degradation by agonist-promoted ubiquitination (PMID: 12960162)
  50. Interaction with beta-arrestin and trafficking patterns by heterodimerization with V1R (PMID: 14757828)
Database Links

HGNC: 897

OMIM: 300538

KEGG: hsa:554

STRING: 9606.ENSP00000338072

UniGene: Hs.567240

Involvement In Disease
Nephrogenic syndrome of inappropriate antidiuresis (NSIAD); Diabetes insipidus, nephrogenic, X-linked (XNDI)
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Kidney.

Q&A

What is the basic structure and function of the human AVPR2 receptor?

AVPR2 is the vasopressin receptor type 2, belonging to the seven-transmembrane-domain G protein-coupled receptor (GPCR) superfamily. It couples to Gs protein, thus stimulating adenylate cyclase when activated. The receptor is primarily expressed in kidney tubules, predominantly in the distal convoluted tubule and collecting ducts, where it responds to the pituitary hormone arginine vasopressin (AVP) to stimulate mechanisms that concentrate urine and maintain water homeostasis in the organism . The structural organization of AVPR2 follows the canonical GPCR architecture with seven transmembrane domains connected by intracellular and extracellular loops, with distinct regions for ligand binding and G-protein coupling.

How does arginine vasopressin (AVP) activate the AVPR2 receptor?

AVP activation of AVPR2 involves specific conformational changes within the receptor structure. Upon AVP binding, V2R undergoes notable conformational alterations including outward displacement of the cytoplasmic end of transmembrane helix 6 (TM6), which is considered a hallmark of GPCR activation . This activation follows a common pathway that directly links the ligand-binding pocket to G-protein coupling regions. The process involves turning of the rotamer "toggle switch" W284^6.48, which translates into rotation and outward movement of TM6 . Additionally, V2R demonstrates receptor-specific activation features compared to other class A GPCRs, including the formation of hydrogen bonds between Y280^6.44 and S127^3.40, as well as between Y280^6.44 and the backbone CO group of V213^5.46, which likely stabilize the active conformation of the receptor .

What are the optimal methods for recombinant expression and purification of AVPR2?

For effective expression and purification of AVPR2, researchers have successfully employed a construct containing specific elements to facilitate expression and purification while maintaining native function. A validated approach involves incorporating a hemagglutinin signal peptide (MKTIIALSYIFCLVFA), Flag-tags, Twin-Strep-tag (WSHPQFEKGGGSGGGSGGGSWSHPQFEK), and a human rhinovirus 3C (HRV3C) protease cleavage site into the N-terminus of the AVPR2 construct .

Additionally, substituting N22 with a glutamine residue prevents N-glycosylation. This construct should be validated in HEK cells to confirm that it retains wild-type pharmacological and functional properties before production in Sf9 insect cells . Validation should include measurement of the dissociation constant (Kd) of fluorescently labeled antagonists, AVP binding assays, cytosolic cAMP accumulation tests, and β-arrestin recruitment assays to ensure full functionality of the recombinant receptor .

How can researchers effectively model the AVPR2 structure for in silico studies?

In silico modeling of AVPR2 presents challenges due to limited template availability. When BLAST similarity searches and multiple alignments fail to identify suitable templates (sequence similarity less than 40%), alternative approaches must be employed . For AVPR2 modeling, researchers can:

  • Use the NCBI reference sequence of vasopressin V2 receptor isoform 1 (Homo sapiens) NP-000045.1 as a starting point .

  • Apply template specification methods in Swiss-model even when sequence identity is low .

  • Estimate model quality using distance constraints methods .

  • Perform structural analyses, secondary structural observations, and mapping of binding regions and GPCR-family conserved residues using visualization software like PyMOL .

  • For predicting effects of mutations, generate mutant structures using wild-type AVPR2 structures as templates, followed by local network analysis of intramolecular interactions .

This methodological approach enables the prediction of structural changes caused by mutations and helps in understanding the molecular basis of receptor function and dysfunction.

What does the cryo-EM structure of AVPR2 reveal about its activation mechanism?

The cryo-electron microscopy (cryo-EM) structure of AVPR2 has provided crucial insights into its activation mechanism. Near-atomic resolution cryo-EM structures of the full-length, Gs-coupled human V2R bound to AVP have been determined . This structure reveals that the cytoplasmic end of TM6 in Gs-coupled V2R undergoes a notable outward displacement during activation, consistent with the common activation mechanism of class A GPCRs .

The structure shows a direct link between the ligand-binding pocket and G-protein coupling regions, involving the rotation of the "toggle switch" W284^6.48, which translates into rotation and outward movement of TM6 . Several distinct features in the active V2R conformation suggest receptor-specific activation mechanisms. For example, the unique physicochemical environment in V2R facilitates hydrogen bond formation between Y280^6.44 and S127^3.40, as well as between Y280^6.44 and the backbone CO group of V213^5.46, which likely stabilize the active receptor conformation .

What is known about the AVPR2-β-arrestin1 complex structure?

The cryo-electron microscopy structure of the wild-type arginine-vasopressin V2 receptor (V2R) in complex with β-arrestin1 provides crucial insights into GPCR-arrestin interactions . This active complex structure elucidates the molecular mechanism of signal transduction and receptor desensitization.

The structure demonstrates how β-arrestin1 binds to the phosphorylated C-terminal tail of activated AVPR2, leading to receptor internalization and signal termination. While specific details of the interface aren't fully provided in the available search results, the successful purification and structural determination of this complex represents a significant advance in understanding GPCR regulation . This structure is particularly important for understanding the biased signaling properties of AVPR2 and has implications for drug design targeting this pathway.

What are the molecular mechanisms by which AVPR2 mutations cause Nephrogenic Diabetes Insipidus?

Mutations in the AVPR2 gene are a primary cause of X-linked Nephrogenic Diabetes Insipidus (NDI), a rare disorder characterized by renal unresponsiveness to vasopressin, leading to excretion of large volumes of diluted urine . Multiple molecular mechanisms have been identified:

  • Impaired transcription: Some mutations affect the proper transcription of the AVPR2 gene.

  • Endoplasmic reticulum retention: Many mutant receptors are misfolded and consequently retained in the endoplasmic reticulum, preventing their trafficking to the cell surface.

  • Defective ligand binding: Some mutants reach the cell surface but cannot properly bind vasopressin.

  • Impaired signal transduction: Other mutants fail to trigger intracellular cAMP signaling despite normal ligand binding .

How can functional characterization of novel AVPR2 variants be performed?

Functional characterization of novel AVPR2 variants involves a multi-faceted approach:

  • Genetic analysis: PCR amplification and direct DNA sequencing of the AVPR2 gene to identify variants, followed by restriction enzyme analysis for confirmation .

  • In silico prediction: Use of prediction tools like PolyPhen-2, SIFT, PROVEAN, and MutationTaster to assess potential pathogenicity .

  • Population database analysis: Checking variant presence in databases like gnomAD and 1000 Genomes Project .

  • Structural modeling: Using Swiss-model to model the mutant receptor structure and predict effects on protein folding and function .

  • Functional assays:

    • Measurement of ligand binding affinity

    • cAMP accumulation assays to assess G-protein coupling

    • β-arrestin recruitment assays

    • Cell surface expression analysis using immunological techniques

    • Coimmunoprecipitation studies to assess protein-protein interactions

  • Classification of variants according to ACMG criteria to determine pathogenicity (e.g., PM1, PM2, PP2, PP3 for "Likely Pathogenic") .

This comprehensive approach enables researchers to determine whether a novel variant is disease-causing and provides insights into the molecular mechanisms of receptor dysfunction.

What rescue strategies exist for functionally inactive mutant AVPR2 receptors?

Several innovative approaches have been developed to rescue functionally inactive mutant AVPR2 receptors:

  • Receptor fragment co-expression: Studies have demonstrated that functionally inactive mutant V2 vasopressin receptors can be rescued by co-expression of a carboxy-terminal V2 receptor fragment (V2-tail) spanning the region where various mutations occur . This approach works through a direct and highly specific interaction between the mutant V2 vasopressin receptor proteins and the V2-tail polypeptide, as demonstrated through coimmunoprecipitation strategies and sandwich ELISA systems .

  • Adenovirus-mediated gene transfer: This has proven to be a highly efficient method for achieving expression of the V2-tail fragment (as well as the wild-type V2 receptor) in various cell types. In Chinese hamster ovary (CHO) cell lines stably expressing low levels of functionally inactive mutant V2 vasopressin receptors, adenovirus infection carrying the V2-tail gene fragment enabled vasopressin to stimulate cAMP formation with high potency and efficacy . Similar success was observed in Madin-Darby canine kidney tubular cells .

  • Pharmacological chaperones: Although not directly mentioned in the search results, this is another established approach where small molecules bind to misfolded receptors in the endoplasmic reticulum, stabilizing them and facilitating their proper folding and trafficking to the cell surface.

These rescue strategies provide potential therapeutic avenues for treating diseases caused by AVPR2 mutations, particularly Nephrogenic Diabetes Insipidus.

How might adenovirus-mediated expression of receptor fragments be developed as a treatment strategy?

Adenovirus-mediated expression of receptor fragments represents a promising therapeutic approach for treating AVPR2-related disorders, particularly Nephrogenic Diabetes Insipidus caused by mutant receptors. The development pathway includes:

  • Construct design: The V2-tail gene fragment must be optimized for expression and incorporated into an appropriate adenoviral vector .

  • Validation in cell culture: As demonstrated in CHO cell lines stably expressing mutant V2 receptors, adenoviral delivery of the V2-tail fragment restored vasopressin's ability to stimulate cAMP formation with high potency and efficacy .

  • Testing in relevant kidney cell models: Successful expression has been achieved in Madin-Darby canine kidney tubular cells, an important model for renal physiology .

  • Mechanism elucidation: Understanding that a direct and specific interaction between the mutant receptor and the V2-tail polypeptide underlies functional rescue is crucial for optimizing the approach .

  • Scaling for therapeutic application: Determining optimal viral titers, expression levels, duration of expression, and potential immune responses.

  • Targeted delivery: Development of kidney-specific targeting strategies to minimize off-target effects.

This approach has broader implications beyond AVPR2-related disorders, as it suggests that adenovirus-mediated expression of receptor fragments may lead to novel strategies for treating a variety of human diseases caused by mutationally inactivated G protein-coupled receptors .

How can in silico methods be used to study AVPR2 hormone binding site interactions?

In silico methods provide valuable tools for studying AVPR2-hormone binding interactions:

  • Docking studies: Molecular docking of AVP to the V2 receptor model helps identify important amino acid residues involved in AVP binding. This approach allows prediction of binding modes and interaction energies between the hormone and receptor .

  • Homology modeling: When direct structural data is unavailable, models can be constructed based on related receptors, though AVPR2 presents challenges due to limited template availability .

  • Multiple sequence alignment: Tools like T-Coffee (Tree-Based Consistency Objective Function for Alignment Evaluation) software can be used to analyze sequence conservation across vasopressin receptors, identifying potential functional motifs .

  • Structure similarity analysis: When sequence similarity is insufficient (less than 40%), structure similarity methods can be attempted, though the RMSD values should be less than 2 for reliable models .

  • Network analysis of intra-molecular interactions: This approach helps predict how mutations affect receptor structure and function by analyzing changes in the local interaction network .

These computational approaches complement experimental studies and can guide the design of experiments, predict the effects of mutations, and assist in drug discovery efforts targeting AVPR2.

What are the latest methods for studying AVPR2 activation and signaling pathways?

Contemporary approaches to studying AVPR2 activation and signaling pathways include:

  • Cryo-electron microscopy: Near-atomic resolution cryo-EM structures of the full-length, Gs-coupled human V2R bound to AVP provide detailed insights into receptor activation mechanisms . This technique has revealed critical conformational changes like the outward displacement of TM6 and rotation of the "toggle switch" W284^6.48 .

  • Site-directed mutagenesis: Experimental validation of key residues identified in structural studies. For example, disease-associated mutations S127^3.40F and Y280^6.44C have been shown to deactivate V2R, confirming their role in receptor activation . Similarly, the alanine mutation of F284^6.44 abolished binding and activation of the related oxytocin receptor .

  • Comparative studies with related receptors: Replacing F284^6.44 in the oxytocin receptor with the V2R-equivalent tyrosine slightly decreased activation by AVP but converted AVP from a partial to a full agonist, providing insights into receptor-specific activation mechanisms .

  • CAMP accumulation assays: For assessing Gs-coupling and receptor activation .

  • β-arrestin recruitment assays: For studying receptor desensitization pathways .

  • Fluorescent ligand binding assays: For determining binding affinities and kinetics .

These methods collectively provide a comprehensive toolkit for dissecting the molecular mechanisms of AVPR2 activation and signaling, essential for understanding receptor function in health and disease.

What is the significance of de novo AVPR2 variants in sporadic cases of Nephrogenic Diabetes Insipidus?

De novo AVPR2 variants play a significant role in sporadic cases of Congenital Nephrogenic Diabetes Insipidus (CNDI). While CNDI typically follows an X-linked recessive inheritance pattern with a known family history, sporadic cases without family history can occur due to de novo mutations . The significance of identifying these de novo variants includes:

  • Diagnostic precision: Identification of de novo disease-causing variants facilitates precise diagnosis of CNDI in patients without family history .

  • Early intervention: Early diagnosis and treatment of CNDI are essential due to the risk of intellectual disability caused by repeated episodes of dehydration and rapid rehydration .

  • Family genetic counseling: Detection of de novo variants provides critical information for future genetic counseling in the family .

  • Understanding disease mechanisms: Novel variants contribute to our understanding of structure-function relationships in AVPR2.

For example, an 80-bp duplication in exon 2 (c.800_879dup) leading to a frameshift and premature stop codon (p.Ala294Profs*4) was identified as a de novo variant in a Swedish male diagnosed with CNDI at 6 months of age during an episode of gastroenteritis . This variant was absent in unaffected family members and healthy controls, confirming its de novo nature and pathogenicity .

What genetic testing strategies are recommended for diagnosing AVPR2-related disorders?

Comprehensive genetic testing strategies for diagnosing AVPR2-related disorders include:

  • PCR amplification and direct DNA sequencing: Analysis of the coding regions of AVPR2 to identify potential variants . This approach successfully identified an 80-bp duplication in exon 2 in a patient with CNDI .

  • Restriction enzyme analysis: Used to confirm variants and test for their presence in family members. For example, MwoI restriction enzyme analysis confirmed the presence of a variant in a patient and his father and its absence in the mother .

  • Variant classification: Using multiple in silico prediction tools (PolyPhen-2, SIFT, PROVEAN, and MutationTaster) to assess potential pathogenicity, along with checking population databases (gnomAD, 1000 Genomes Project) for variant frequency .

  • ACMG criteria application: Applying American College of Medical Genetics criteria to classify variants (e.g., "Likely Pathogenic" based on criteria PM1, PM2, PP2, PP3) .

  • Functional validation: When possible, functional studies to assess the impact of the variant on receptor expression, trafficking, and signaling .

  • Prenatal testing: For at-risk pregnancies in families with known disease-causing variants .

These strategies are particularly important for early diagnosis in sporadic cases, which can occur due to de novo variants in AVPR2 or through several generations of female transmission of the disease-causing variant .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.