Recombinant Human Vesicle-associated membrane protein 1 (VAMP1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Human Vesicle-associated membrane protein 1 (VAMP1) is a synthetic variant of the naturally occurring VAMP1, a critical component of the SNARE complex involved in regulated exocytosis. VAMP1 facilitates vesicle fusion with target membranes, enabling neurotransmitter release, hormone secretion, and cellular signaling. Its recombinant form is widely used in biochemical studies to investigate vesicle trafficking, neurodegenerative diseases, and viral replication mechanisms .

Structure and Function

VAMP1 is a type IV transmembrane protein with a cytoplasmic domain (amino acids 1–96) and a short transmembrane domain (amino acids 97–118) . It binds syntaxin and SNAP25 to form the SNARE complex, driving membrane fusion . Key structural features include:

  • Coiled-coil region (aa 33–93): Mediates interactions with other SNARE proteins .

  • Alternative splice variants: Some isoforms include mitochondrial targeting motifs or altered C-terminal sequences .

Alzheimer’s Disease

  • Role in Aβ Exocytosis: VAMP1 knockdown in neurons reduces amyloid-β (Aβ) secretion by up to 74%, suggesting its potential as a therapeutic target .

  • Genetic Association: Polymorphisms increasing VAMP1 expression correlate with higher Alzheimer’s risk, while protective variants reduce disease susceptibility .

Hereditary Spastic Ataxia

  • Splicing Mutation: A disrupted donor site in VAMP1 leads to loss of the neuron-specific isoform (VAMP1A), causing spastic paraplegia and ataxia .

TRPV1/TRPA1 Trafficking

  • TNFα-Induced Exocytosis: VAMP1 mediates TNFα-driven surface trafficking of TRPV1 and TRPA1 channels in sensory neurons, distinct from VAMP2/3 .

StudyKey FindingCitation
Alzheimer’s Aβ Secretion74% reduction in Aβ exocytosis with VAMP1 knockdown
Ataxia MutationLoss of VAMP1A isoform linked to spastic ataxia
TRPV1/TRPA1 TraffickingVAMP1 essential for TNFα-induced channel insertion

Clinical and Pathological Significance

  • Congenital Myasthenic Syndrome: Homozygous VAMP1 mutations impair presynaptic vesicle fusion, mimicking symptoms of botulinum toxin intoxication .

  • Lung Cancer Survival: Higher VAMP1 expression correlates with improved survival outcomes in lung cancer patients .

  • Viral Exploitation: VAMP1 interacts with viral proteins (e.g., HCV NS5A, HSV-1) to facilitate replication and nuclear egress .

Biochemical Properties and Interactions

  • Botulinum Neurotoxin Sensitivity: Cleaved by botulinum toxin B (BoNT/B), disrupting neurotransmitter release .

  • Viral Interactions: VAMP1 associates with phosphatidylinositol transfer proteins (NIR2, OSBP) to support viral membrane remodeling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us for preferential development.
Synonyms
VAMP1; SYB1; Vesicle-associated membrane protein 1; VAMP-1; Synaptobrevin-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
VAMP1
Target Protein Sequence
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT
Uniprot No.

Target Background

Function
Vesicle-associated membrane protein 1 (VAMP1) plays a crucial role in the targeting and fusion of transport vesicles with their designated target membranes.
Gene References Into Functions
  1. Homozygous VAMP1 mutations are associated with presynaptic congenital myasthenic syndrome. (PMID: 28253535)
  2. Residue 48 of VAMP1 exhibits frequent variation between methionine (M) and isoleucine (I) across primate species, suggesting potential selective pressure for resistance to botulinum neurotoxins. (PMID: 25010769)
  3. Genetically regulated VAMP1 expression in the brain may influence Alzheimer's disease risk and contribute to its pathogenesis. (PMID: 25881291)
  4. VAMP1, encoding a crucial protein for synaptic exocytosis, has been identified as the causative gene for a dominantly inherited spastic ataxia. (PMID: 22958904)
  5. Multiple domains beyond the R-SNARE region of tomosyn are essential for its effective inhibition of exocytotic secretion. (PMID: 21330375)
Database Links

HGNC: 12642

OMIM: 108600

KEGG: hsa:6843

STRING: 9606.ENSP00000379602

UniGene: Hs.20021

Involvement In Disease
Spastic ataxia 1, autosomal dominant (SPAX1)
Protein Families
Synaptobrevin family
Subcellular Location
[Isoform 1]: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome.; [Isoform 2]: Cytoplasmic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome.; [Isoform 3]: Mitochondrion outer membrane; Single-pass type IV membrane protein.
Tissue Specificity
Nervous system, skeletal muscle and adipose tissue.

Q&A

What is the functional role of VAMP1 in neuronal systems?

VAMP1 is a key protein in the SNARE complex that facilitates vesicle fusion and neurotransmitter release at synapses. It plays a crucial role in neuronal exocytosis, including the secretion of proteins such as amyloid-beta (Aβ). Studies have demonstrated that VAMP1 expression levels directly correlate with Aβ secretion, with decreased VAMP1 protein expression leading to significantly reduced Aβ40 and Aβ42 secretion in neuronal cultures . This relationship is particularly important in understanding Alzheimer's disease pathophysiology, as VAMP1 appears to control the release of pathological proteins found in the Alzheimer's brain.

To study this function in laboratory settings, researchers typically use genetic manipulation approaches, including:

  • shRNA-mediated knockdown in primary neurons

  • Heterozygous VAMP1+/- mouse models

  • Genetic association studies examining natural polymorphisms

How does recombinant human VAMP1 protein differ from native neuronal VAMP1?

Recombinant human VAMP1 protein (such as ab63841) is typically produced as a fragment protein (amino acids 1-91) with a His-tag expressed in bacterial systems like Escherichia coli . While this provides a high-purity (>95%) research tool, there are several important differences from native VAMP1 to consider:

  • Post-translational modifications: Bacterial expression systems lack many mammalian post-translational modification pathways

  • Protein folding: Recombinant proteins may have subtle conformational differences

  • Fragment nature: The aa 1-91 fragment lacks the transmembrane domain of full-length VAMP1

  • His-tag presence: The N-terminal His-tag (MGSSHHHHHHSSGLVPRGSHM) may affect protein interactions

These differences must be considered when designing experiments, particularly when studying protein-protein interactions or when using recombinant VAMP1 as a standard in quantitative assays.

What experimental paradigms are most suitable for studying VAMP1 function?

When studying VAMP1 function, researchers should consider these experimental approaches:

  • Primary neuronal cultures: These provide the most physiologically relevant system for studying VAMP1's role in vesicle fusion and Aβ secretion. In published studies, researchers cultured neurons for 4-8 days before measuring secreted Aβ levels via ELISA, finding significant differences only became apparent by day 8 .

  • Genetic manipulation models: VAMP1+/- mouse models show reduced soluble Aβ40 and Aβ42 in 10-day old mice compared to wildtype .

  • Luciferase reporter assays: For studying polymorphism effects on VAMP1 expression, dual luciferase reporter gene assays in cell lines like HepG2 have successfully demonstrated functional consequences of genetic variants .

How do genetic polymorphisms affect VAMP1 expression and what are the implications for Alzheimer's disease research?

Genetic polymorphisms significantly influence VAMP1 expression levels in the brain, with considerable implications for Alzheimer's disease risk. Research has identified several key polymorphisms:

PolymorphismEffect on VAMP1 ExpressionAssociation with Alzheimer's Disease Risk
rs7390Increased expression (β=0.41, p=4×10^-15)Increased risk (OR=1.07)
rs2240867Increased expressionSlightly decreased risk (OR=0.98)
rs12964Decreased expression (β=-0.41, p<2×10^-9)Protective effect (OR=0.94)
rs2072375Decreased expressionProtective effect (OR=0.89)
rs2072376Decreased expressionProtective effect (OR=0.88, p=0.03)

This data reveals a trend where polymorphisms associated with increased VAMP1 expression confer higher Alzheimer's disease risk (mean OR=1.025) compared to those associated with decreased expression (mean OR=0.90) . The difference between these risk profiles is statistically significant (p=0.03), suggesting VAMP1 expression level is an important factor in disease pathology.

For researchers, this suggests VAMP1 genotyping should be considered when designing Alzheimer's disease studies, particularly when assessing experimental interventions that might affect VAMP1 expression or function.

What mechanisms link VAMP1 protein levels to amyloid-beta secretion?

The relationship between VAMP1 protein levels and Aβ secretion has been established through multiple experimental approaches. Primary mouse neurons with shRNA-mediated VAMP1 knockdown (achieving 37.6% reduction in VAMP1 protein) demonstrated significantly decreased Aβ secretion:

  • 72% reduction in Aβ40 secretion (p<0.0001)

  • 81% reduction in Aβ42 secretion (p<0.0001)

Similarly, neurons from VAMP1+/- mice showed:

  • 51% reduction in Aβ40 secretion (p<0.0001)

  • 73% reduction in Aβ42 secretion (p<0.0001)

These findings establish VAMP1 as a critical mediator of neuronal Aβ exocytosis, likely through its role in the SNARE complex responsible for vesicle fusion. Interestingly, complete VAMP1 knockout (VAMP1-/-) did not show the same reduction, suggesting compensatory mechanisms may exist when VAMP1 is entirely absent.

When designing experiments to study this relationship, researchers should:

  • Include time-course measurements (significant differences emerged only after 8 days in culture)

  • Consider both Aβ40 and Aβ42 species

  • Assess both secreted and intracellular Aβ levels to distinguish between secretion defects and production changes

How should VAMP1 expression data from different brain regions be interpreted in Alzheimer's disease studies?

VAMP1 expression is regulated by genetic polymorphisms across multiple brain regions, but key research has focused on cerebellar expression. When interpreting VAMP1 expression data:

What are the critical variables to control when designing experiments with recombinant VAMP1?

When designing experiments involving recombinant VAMP1, researchers must carefully control several variables to ensure valid results:

  • Independent variables to consider:

    • VAMP1 concentration/expression level

    • Genetic background (wild-type vs. polymorphism carriers)

    • Cell type or model system (neuronal vs. non-neuronal)

    • Duration of experiment (especially important as VAMP1 effects on Aβ secretion show time-dependence)

  • Dependent variables to measure:

    • VAMP1 mRNA expression levels

    • VAMP1 protein expression levels

    • Vesicle fusion efficiency

    • Aβ secretion (both Aβ40 and Aβ42)

  • Extraneous variables to control:

    • Age of subjects/samples (for human studies)

    • Sex (should be balanced or accounted for in analysis)

    • APOE ε4 allele status (known Alzheimer's risk factor)

    • Culture conditions (for in vitro studies)

Following a between-subjects or within-subjects design must be explicitly determined, with randomization of subjects to control and treatment groups whenever possible to minimize research bias .

How can researchers effectively manipulate VAMP1 expression in experimental models?

Several approaches have proven effective for manipulating VAMP1 expression in experimental systems:

  • shRNA-mediated knockdown: Successfully achieved 37.6% reduction in VAMP1 protein expression in primary mouse neurons, sufficient to demonstrate significant effects on Aβ secretion .

  • Heterozygous knockout models: VAMP1+/- mice show reduced VAMP1 expression and decreased Aβ secretion compared to wild-type littermates. This approach allows for in vivo assessment of VAMP1 reduction effects .

  • Polymorphism-based approaches: Utilizing naturally occurring polymorphisms that affect VAMP1 expression levels. For example, rs7390 is associated with increased expression while rs12964 is associated with decreased expression .

  • Luciferase reporter constructs: Dual luciferase reporter gene assays can be used to test how specific polymorphisms affect VAMP1 expression in controlled cellular environments .

The method selection should be based on research questions - genetic manipulation provides mechanistic insights, while polymorphism studies offer translational relevance to human disease.

What controls and validation steps are essential when studying VAMP1 in Alzheimer's disease models?

When studying VAMP1 in Alzheimer's disease contexts, researchers should implement these controls and validation steps:

  • Expression validation: Confirm VAMP1 knockdown or overexpression at both mRNA and protein levels. Research shows VAMP1 transcript levels may not always correlate with functional outcomes in disease states .

  • Temporal controls: Include multiple time points in experimental design. Significant differences in Aβ secretion between control and VAMP1-knockdown neurons only became apparent after 8 days in culture, not at 4 days .

  • Genetic background controls: When using polymorphism-based approaches, adjust for age, sex, and APOE ε4 allele status, as these factors influence Alzheimer's disease risk independently .

  • Functional validation: For recombinant protein studies, confirm that the His-tagged fragment protein (aa 1-91) maintains relevant functional properties of native VAMP1 .

  • Hardy-Weinberg equilibrium testing: When studying rare VAMP1 variants (like rs74056956 and rs71584834), verify genotype distributions conform to Hardy-Weinberg equilibrium, as deviations may indicate genotyping errors or selection bias .

How should researchers address contradictory findings in VAMP1 expression studies?

When confronting contradictory findings in VAMP1 research, implement this analytical framework:

  • Examine tissue-specific effects: While genetic regulation of VAMP1 appears consistent across tissues (cerebellum and lymphoblastoid cells show similar effects), the magnitude may vary. Compare effect sizes (β coefficients) across tissues - research shows rs7390 had β=0.41 in cerebellum versus β=0.51 in lymphoblastoid cells .

  • Consider disease state interactions: Some polymorphisms (e.g., rs2072376) affect VAMP1 expression differently in Alzheimer's disease patients compared to controls. Always analyze disease and control groups separately before combining .

  • Evaluate complete versus partial loss models: Complete loss of VAMP1 (VAMP1-/- mice) may trigger compensatory mechanisms not present in partial reduction models (VAMP1+/- mice or shRNA knockdown). This explains why some studies show no effect with complete knockout but significant effects with partial reduction .

  • Assess temporal factors: Contradictory results may stem from different experimental durations. For example, Aβ secretion differences between control and VAMP1-knockdown neurons were negligible at 4 days but substantial at 8 days .

What statistical approaches are most appropriate for analyzing VAMP1 genetic association data?

When analyzing VAMP1 genetic association data, researchers should employ these statistical approaches:

  • Model testing: Examine dominant, additive, and recessive genetic models, as VAMP1 polymorphisms may operate differently. For example, rs2072376 showed a protective effect against Alzheimer's disease only in the recessive model (OR=0.88, p=0.03) .

  • Covariate adjustment: Always adjust for established confounders:

    • Age

    • Sex

    • APOE ε4 allele status

  • Meta-analysis approaches: When analyzing data across multiple populations, assess heterogeneity before combining. Even with low heterogeneity (0%, p=0.62), effect size variations across subpopulations can lead to non-significant meta-analysis results despite significant findings in individual populations .

  • Expression quantitative trait loci (eQTL) analysis: When linking genetic variants to expression, use appropriate regression models. The studies shown report β coefficients, where negative values represent decreased expression and positive values indicate increased expression .

  • Hardy-Weinberg equilibrium testing: This is critical for rare variants. Studies found deviation from Hardy-Weinberg equilibrium in several subpopulations for rare VAMP1 variants rs74056956 and rs71584834, potentially invalidating their association results .

How can researchers effectively translate VAMP1 findings from cellular models to human disease implications?

Translating VAMP1 research from cellular models to human disease relevance requires addressing several methodological challenges:

  • Integrate expression and genetic risk data: Research demonstrates a relationship where polymorphisms associated with increased VAMP1 expression confer higher Alzheimer's disease risk (mean OR=1.025) than those associated with decreased expression (mean OR=0.90, p=0.03) . Use this relationship as a framework for interpreting cellular findings.

  • Validate cellular phenotypes in multiple systems: Findings from primary neuron cultures should be verified in heterozygous animal models when possible. Research showed consistent reduction in Aβ secretion in both shRNA-knockdown neurons and neurons from VAMP1+/- mice .

  • Connect molecular phenotypes to brain pathology: VAMP1+/- mice had reduced soluble Aβ40 and Aβ42 in brain tissue compared to wild-type mice, providing a link between cellular findings and potential disease-relevant endpoints .

  • Use functional validation of genetic variants: Employ dual luciferase reporter gene assays to confirm that genetic variants associated with altered expression in human populations actually affect gene expression in controlled cellular systems .

  • Consider effect size and population relevance: While rs2072376 showed a modest protective effect against Alzheimer's disease (OR=0.88), its high minor allele frequency (MAF=41%) means it could have substantial population-level impact compared to rare variants with stronger effects but limited population prevalence .

What are the most promising approaches for targeting VAMP1 in Alzheimer's disease therapeutic development?

Based on current evidence linking VAMP1 expression to Alzheimer's disease pathology, several research directions show therapeutic potential:

  • Targeted modulation of VAMP1 expression: Since decreased VAMP1 expression is associated with reduced Aβ secretion and potentially decreased Alzheimer's disease risk, developing compounds that selectively downregulate VAMP1 could be therapeutically beneficial .

  • Polymorphism-guided precision medicine: Patients could be stratified based on VAMP1 polymorphism status, with those carrying high-expression variants (e.g., rs7390) potentially benefiting more from VAMP1-targeted therapies than those with protective variants (e.g., rs2072376) .

  • SNARE complex modulation: Rather than targeting VAMP1 alone, developing compounds that modulate the entire SNARE complex function might provide more precise control over pathological protein secretion while preserving essential neurotransmission .

  • Combination approaches: Future research should explore combining VAMP1-targeted approaches with other established therapeutic targets in Alzheimer's disease, potentially achieving synergistic effects through multiple pathway modulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.