Recombinant Human Vesicle-associated membrane protein 4 (VAMP4)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Human VAMP4

Recombinant Human VAMP4 is a laboratory-engineered form of the vesicle-associated membrane protein 4 (VAMP4), a SNARE (soluble NSF attachment protein receptor) family member critical for intracellular vesicle trafficking. This protein is produced using recombinant DNA technology, enabling precise study of its structure, interactions, and functional roles in cellular processes such as insulin secretion, synaptic vesicle release, and trans-Golgi network (TGN)-to-endosome transport .

3.1. Insulin Homeostasis Regulation

VAMP4 controls insulin levels by targeting immature insulin secretory granules (iISGs) and clathrin-coated vesicles (CCVs) to lysosomes. In pancreatic β-cells:

  • Mechanism: Forms a SNARE complex with STX7, STX8, and VTI1B to mediate vesicle-lysosome fusion .

  • Knockout Effects: VAMP4 deficiency increases blood insulin levels, intracellular proinsulin accumulation (+14–23%), and glucose hyperresponsiveness .

3.2. Synaptic Vesicle Release Probability

VAMP4 modulates synaptic vesicle (SV) release probability (Pr) via endolysosomal targeting:

  • Activity-Dependent Clearance: VAMP4 turnover increases during neuronal activity, reducing SV fusion competence .

  • Knockout Phenotype: Elevated Pr, impaired short-term facilitation, and synaptic depression .

3.3. TGN-to-Endosome Transport

VAMP4 colocalizes with syntaxin 6 on clathrin-coated TGN membranes and mediates retrograde/anterograde trafficking .

4.2. Pathophysiological Implications

  • Diabetes: VAMP4 deficiency improves glucose tolerance but increases proinsulin:insulin ratios, suggesting dysregulated granule maturation .

  • Neurodegeneration: Altered VAMP4 dynamics correlate with synaptic senescence and excitotoxicity .

Applications in Research

Recombinant VAMP4 is used to:

  1. Study SNARE complex assembly and vesicle fusion mechanisms .

  2. Investigate insulin granule trafficking defects in diabetes models .

  3. Screen for modulators of synaptic transmission .

Limitations and Challenges

  • Species Specificity: Most studies use rodent models; human cell data remain limited .

  • Functional Redundancy: Overlapping roles with VAMP3 and VAMP7 complicate phenotype interpretation .

Future Directions

  • Therapeutic Targeting: VAMP4 inhibition may enhance insulin secretion in diabetes but risks synaptic dysfunction .

  • High-Resolution Imaging: Live-cell tracking of recombinant VAMP4 to map vesicle-lysosome fusion dynamics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please specify your preference during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
VAMP4; Vesicle-associated membrane protein 4; VAMP-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
VAMP4
Target Protein Sequence
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT
Uniprot No.

Target Background

Function
VAMP4 is involved in the pathway responsible for removing an inhibitor (likely synaptotagmin-4) of calcium-triggered exocytosis during secretory granule maturation. It may serve as a marker for this sorting pathway, which is crucial for remodeling the secretory response of granules.
Gene References Into Functions
  1. Syntaxin 6 and VAMP4 colocalize to the chlamydial inclusion. PMID: 23798538
  2. Evidence suggests that depletion of VAMP4, syntaxin 6, syntaxin 16, and Vti1a disrupts the Golgi ribbon structure. PMID: 23677696
  3. Colocalization of ATP11B with fluorescent cisplatin and with vesicular trafficking proteins, such as STX6 and VAMP4, strongly indicates that ATP11B contributes to the secretory vesicular transport of cisplatin from the Golgi to the plasma membrane. PMID: 23585472
  4. Findings from this study suggest that VAMP4 and syb2 diverge functionally, traffic independently, and support distinct forms of neurotransmission. PMID: 22406549
  5. VAMP7 is involved in numerous fusion processes and thus plays a more general role in NK-cell activity than VAMP4. PMID: 21805468

Show More

Hide All

Database Links

HGNC: 12645

OMIM: 606909

KEGG: hsa:8674

STRING: 9606.ENSP00000236192

UniGene: Hs.6651

Protein Families
Synaptobrevin family
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Single-pass type IV membrane protein. Note=Associated with trans Golgi network (TGN) and newly formed immature secretory granules (ISG). Not found on the mature secretory organelles.

Q&A

What is the structural characterization of recombinant human VAMP4?

Recombinant human VAMP4 is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family of trafficking proteins, which are critical components of the SNARE (soluble N-ethylmaleimide-sensitive factor attachment protein receptor) complex. The protein consists of a cytoplasmic domain (amino acids 2-115 in the human form) and a transmembrane region . Like other R-SNAREs, VAMP4 contributes one α-helix to the four-helix bundle that forms the SNARE complex core structure. The central ionic layer of this complex contains an arginine residue from VAMP4 that interacts with glutamate residues from partner SNAREs .

When producing recombinant VAMP4 for research purposes, expression constructs typically include the cytoplasmic domain fused to tags such as GST (glutathione S-transferase) to facilitate purification. For antibody production, thrombin cleavage can separate the VAMP4 protein from the GST tag, allowing for the isolation of the native protein structure .

What is the subcellular localization pattern of VAMP4?

VAMP4 displays a distinct subcellular localization pattern that has been characterized through both immunofluorescence and electron microscopy techniques. In mammalian cells:

  • The majority of VAMP4 (approximately 45-50%) localizes to tubular and vesicular membranes of the trans-Golgi network (TGN), which are in part coated with clathrin

  • VAMP4 is found on both clathrin-coated and non-coated vesicles

  • Additional labeling is present on endosomes and the medial and trans side of the Golgi complex

  • In PC12 cells, VAMP4 is also present on immature secretory granules

In neuronal tissues, VAMP4 shows dense labeling throughout the brain, suggesting a widespread role . In primary cultures of hippocampal neurons:

  • Prominent immunofluorescence for VAMP4 is present in neuronal cell bodies, mirroring the distribution of its interaction partner AP1 (associated with TGN and endosomes)

  • Discrete punctate immunoreactivity for VAMP4 is detected in presynaptic terminals, albeit at lower levels compared to cell bodies

  • Biochemical fractionation confirms VAMP4 enrichment in both cell body organelles and synaptic vesicles

This distribution pattern suggests VAMP4's dual role in both TGN trafficking and synaptic vesicle dynamics.

What are the recommended methods for expression and purification of recombinant human VAMP4?

For successful expression and purification of recombinant human VAMP4:

  • Expression System Selection:

    • E. coli expression systems are commonly used for the cytoplasmic domain (amino acids 2-115)

    • Fusion tags such as GST are typically employed to enhance solubility and facilitate purification

  • Purification Protocol:

    • Affinity chromatography using GST-fusion proteins bound to appropriate matrix (e.g., CNBr-activated Sepharose beads)

    • Thrombin cleavage to separate VAMP4 from the GST tag

    • Further purification may involve size exclusion chromatography or ion exchange chromatography

  • Quality Control Measures:

    • SDS-PAGE to verify protein size and purity

    • Western blotting with specific antibodies

    • Functional verification through binding assays with known interaction partners like syntaxin 6

When planning experiments with recombinant VAMP4, researchers should consider the specific domain requirements for their application, as the transmembrane domain may be necessary for certain studies while the cytoplasmic domain alone is sufficient for others.

How does VAMP4 targeting to endolysosomes affect synaptic vesicle release probability?

VAMP4 plays a critical regulatory role in controlling synaptic vesicle (SV) release probability (Pr) through its targeting to endolysosomes. Research has revealed several important mechanisms:

  • Activity-dependent regulation: VAMP4 has unusually high synaptic turnover and is selectively sorted to endolysosomes during activity-dependent bulk endocytosis . This dynamic trafficking affects the availability of VAMP4 at synaptic release sites.

  • Impact on release probability: Knockout (KO) of VAMP4 results in significantly increased Pr at synapses . Specifically:

    • VAMP4 KO neurons show markedly increased fluorescence amplitudes when stimulated with a 40-action potential (AP) train compared to wild-type neurons

    • This effect is not due to changes in the total recycling pool (TRP) of vesicles, as responses after a subsequent 900-AP train are equal between VAMP4 KO and wild-type neurons

    • The elevated Pr phenotype can be rescued by overexpression of wild-type VAMP4 in KO neurons

  • Effect on short-term synaptic dynamics: VAMP4 is critical for controlling short-term synaptic facilitation:

    • VAMP4 KO circuits display an inability to sustain presynaptic facilitation during trains of stimuli

    • Hippocampal VAMP4 KO slices demonstrate significant depression of synaptic responses during short AP bursts compared to wild-type tissue

These findings collectively indicate that VAMP4's targeting to endolysosomes serves as a mechanism to regulate the fusion competence of synaptic vesicles in the readily releasable pool, thereby modulating synaptic strength and short-term plasticity during neuronal activity.

What molecular mechanisms underlie VAMP4's role in SNARE complex formation during synaptic activity?

The molecular mechanisms through which VAMP4 influences SNARE complex formation during synaptic activity involve several key aspects:

  • Differential SNARE complex formation efficiency: VAMP4 does not form SNARE complexes with plasma membrane Q-SNAREs as efficiently as synaptobrevin 2 (syb2) during neuronal activity . This reduced efficiency may be due to structural differences between VAMP4 and canonical SV SNAREs.

  • Interaction with specific SNARE partners: VAMP4 preferentially forms complexes with syntaxin 6, as demonstrated by co-immunoprecipitation studies from rat brain detergent extracts . This selective interaction guides VAMP4 toward specific trafficking pathways.

  • Complex formation during different activity states: During synaptic activity, VAMP4's participation in SNARE complex formation differs from canonical SNAREs:

    • Only about 25% of VAMP4-pHluorin molecules visit the cell surface at active synapses during high-frequency stimulation (40 Hz, 10 s)

    • In contrast, syb2-pHluorin responses track closely with synaptophysin-mOrange2 and report SV fusion events at nearly 100% of active synapses

    • VAMP4 expression at active synapses is significantly lower when expressed relative to syb2

  • Structural determinants: The specific amino acid sequences that determine VAMP4's SNARE complex formation properties appear to include both the SNARE motif and regulatory regions that control its trafficking and availability.

This restricted participation in SNARE complex formation during activity suggests that VAMP4 serves as a molecular brake on vesicle fusion, potentially by competing with more fusion-competent SNAREs or by directing vesicles away from release sites toward endolysosomal pathways.

What analytical techniques are most effective for studying VAMP4-containing SNARE complexes?

Several sophisticated analytical techniques have proven effective for investigating VAMP4-containing SNARE complexes:

  • Proteomic approaches:

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) using high-resolution instruments (resolution 120,000 at m/z 200)

    • Data-dependent acquisition with Top 20 method for MS/MS scans

    • Label-free quantification or isotope labeling for comparative studies

  • Biochemical methods:

    • Co-immunoprecipitation with anti-VAMP4 antibodies from detergent extracts (typically from rat brain)

    • SDS-resistant SNARE complex isolation (these complexes typically migrate at 7S in density gradients)

    • Thrombin cleavage assays to separate protein domains

  • Advanced microscopy techniques:

    • Indirect immunofluorescence combined with electron microscopy for precise subcellular localization

    • Double-labeling protocols with protein A-gold particles of different sizes (10 nm and 15 nm) for co-localization studies

    • Live-cell imaging with pH-sensitive fluorescent reporters (pHluorin-tagged proteins) to monitor trafficking dynamics

  • Data analysis approaches:

    • Statistical analysis using appropriate tests for normal or non-Gaussian data distributions

    • Bioinformatic analysis of proteomic data using specialized software (e.g., Perseus, Enrichr)

    • Gene Ontology (GO) term enrichment analysis for functional clustering

The choice of technique should be guided by the specific research question, with combinations of these methods often providing the most comprehensive insights into VAMP4 function and interactions.

What are the phenotypic consequences of VAMP4 knockout in neuronal circuits?

VAMP4 knockout produces several distinct phenotypic consequences in neuronal circuits that reveal its critical role in synaptic function:

  • Altered release probability and synaptic dynamics:

    • Significantly increased synaptic vesicle release probability (Pr) in hippocampal circuits

    • Inability to sustain presynaptic facilitation during trains of stimuli

    • Pronounced depression of synaptic responses during short action potential bursts (10 APs at 20 Hz)

  • Synaptic vesicle pool dynamics:

    • Increased fluorescence amplitudes evoked by a 40-AP train in VAMP4 KO neurons compared to wild-type

    • No change in the total recycling pool (TRP) size, as measured by responses to 900 APs

    • Robust depression of SV fusion revealed when normalizing responses to initial release probability

  • Molecular and functional rescue:

    • Both elevated Pr and augmented release depression can be fully restored by overexpression of wild-type VAMP4 in KO neurons

    • This suggests that the absence of VAMP4 specifically increases the fusion competence of SVs in the readily releasable pool without affecting the total number of recycling SVs

  • Glutamate release dynamics:

    • VAMP4 KO neurons show depression of iGluSnFR responses in axons when challenged with short AP bursts

    • Neither readily releasable pool (RRP) size nor its replenishment during stimulus trains is significantly affected in VAMP4 KO slices

These phenotypic changes collectively suggest that VAMP4 plays a critical role in controlling short-term synaptic plasticity by regulating the release probability of synaptic vesicles during trains of action potentials. This function is likely mediated through VAMP4's targeting to endolysosomes during neuronal activity.

How can recombinant VAMP4 be utilized for binding partner identification and validation?

Recombinant VAMP4 serves as a powerful tool for identifying and validating binding partners in trafficking pathways. The following methodological approaches are recommended:

  • Pull-down assays:

    • Express full-length cytoplasmic domain (amino acids 2-115) of human VAMP4 fused to GST

    • Immobilize the fusion protein on glutathione-Sepharose beads

    • Incubate with cellular lysates from relevant tissues (e.g., brain extracts)

    • Elute bound proteins and identify by immunoblotting or mass spectrometry

  • Co-immunoprecipitation with validated antibodies:

    • Generate and affinity-purify antibodies using recombinant VAMP4

    • For antibody purification, first pre-clear sera with GST-coupled beads, then affinity-purify using thrombin-cleaved recombinant VAMP4 coupled to CNBr-activated Sepharose beads

    • Use these antibodies to immunoprecipitate native VAMP4 complexes from detergent extracts of relevant tissues

  • Mass spectrometry-based identification:

    • Process immunoprecipitated samples for LC-MS/MS analysis

    • Use high-resolution instruments (120,000 at m/z 200) with data-dependent acquisition

    • Apply appropriate statistical filtering (p<0.05) and fold change thresholds (≥1.5) to identify significant interactions

  • Validation of interactions:

    • Confirm direct binding through in vitro assays with purified components

    • Validate cellular relevance through co-localization studies combining indirect immunofluorescence and electron microscopy

    • Use protein A-gold particles of different sizes (e.g., 10 nm and 15 nm) for double-labeling experiments

This systematic approach has successfully identified syntaxin 6 as a key binding partner of VAMP4 in the trans-Golgi network, suggesting their combined role in TGN-to-endosome transport .

What controls should be included when studying VAMP4 trafficking in live neurons?

When designing experiments to study VAMP4 trafficking in live neurons, several critical controls should be included:

  • Reporter validation controls:

    • Include parallel experiments with well-characterized vesicle proteins (e.g., synaptophysin, synaptobrevin 2) tagged with the same fluorescent reporters

    • For pH-sensitive reporters like pHluorin, verify responses to pH changes using calibration solutions

    • Ensure that reporter fusion constructs maintain proper targeting and don't interfere with protein function

  • Activity stimulation controls:

    • Compare responses to different stimulation paradigms (e.g., single action potentials vs. trains at varying frequencies)

    • Include tetrodotoxin (TTX) conditions to block action potential-evoked release

    • Use direct depolarization (high K+) as a positive control for maximal vesicle fusion

  • Co-trafficking controls:

    • Use dual-color imaging with established markers (e.g., syp-mOr2) to identify active synapses

    • Classification of synapses should be based on responses to these established markers before analyzing VAMP4 dynamics

    • Quantify relative expression levels of different reporters to control for expression artifacts

  • Specificity controls for imaging:

    • For electron microscopy studies, perform double-labeling controls where secondary antibodies are omitted to verify specificity of immunogold labeling

    • Include glutaraldehyde fixation between labeling steps to prevent cross-reactivity

    • Quantify background labeling in non-relevant compartments

Following these control measures will ensure robust and reproducible results when studying the unique trafficking dynamics of VAMP4 in neuronal systems.

How should experimental conditions be optimized for studying VAMP4's role in different cell types?

Optimizing experimental conditions for studying VAMP4 across different cell types requires careful consideration of several parameters:

  • Cell type-specific expression systems:

    • For neuronal studies: Primary hippocampal or cortical cultures (14-21 DIV) are preferred for studying synaptic functions

    • For trafficking studies: PC12 cells provide a good model for regulated secretory pathways

    • For TGN functions: Epithelial cell lines such as NRK (normal rat kidney) cells are suitable

  • Transfection/transduction optimization:

    • Adjust transfection protocols for different cell types (lipofection for cell lines, calcium phosphate or viral transduction for neurons)

    • Optimize expression timing: 48-72 hours post-transfection for most studies

    • Control expression levels to avoid overexpression artifacts that may disrupt normal trafficking

  • Stimulation paradigms:

    • For neurons: Use electrical field stimulation with defined action potential numbers and frequencies (e.g., 40 Hz for 10 seconds to visualize VAMP4 trafficking)

    • For non-neuronal cells: Employ physiologically relevant secretion triggers specific to the cell type

  • Imaging parameters:

    • Adjust acquisition settings based on subcellular compartment size and protein abundance

    • For TGN imaging: Higher magnification (25,000×) electron microscopy is recommended

    • For synaptic vesicle studies: Rapid time-lapse imaging (≥10 Hz) is necessary to capture fast kinetics

  • Analysis methods:

    • Quantify compartment-specific distribution using standardized criteria for identifying cellular structures

    • For neurons, separate analysis of cell bodies versus synaptic compartments is essential

    • Apply appropriate statistical tests based on data distribution (parametric vs. non-parametric)

By tailoring these experimental conditions to the specific cell type and research question, researchers can effectively study VAMP4's diverse roles across different cellular contexts.

What are the recommended approaches for studying VAMP4 endolysosomal targeting mechanisms?

To effectively investigate VAMP4 endolysosomal targeting mechanisms, researchers should consider these methodological approaches:

  • Molecular determinants analysis:

    • Generate targeted mutations in potential sorting motifs within VAMP4

    • Create chimeric proteins between VAMP4 and other SNAREs to identify targeting domains

    • Express these constructs in relevant cell types and assess their localization and trafficking

  • Live-cell trafficking assays:

    • Employ pH-sensitive reporters (pHluorin) fused to VAMP4 to monitor surface delivery and internalization

    • Use dual-color imaging with established endolysosomal markers

    • Quantify endolysosomal targeting during different stimulation paradigms:

      • High-frequency stimulation (40 Hz, 10s) to trigger activity-dependent bulk endocytosis

      • Drug treatments that perturb specific trafficking pathways

  • Interactome analysis:

    • Identify VAMP4-interacting proteins through co-immunoprecipitation followed by mass spectrometry

    • Focus on interaction partners involved in endolysosomal sorting (e.g., AP1, PACS1)

    • Validate key interactions through techniques like proximity ligation assays

  • Ultrastructural approaches:

    • Use immunogold electron microscopy to precisely localize VAMP4 in endolysosomal compartments

    • Perform double-labeling with established markers of different endosomal/lysosomal compartments

    • Quantify the distribution of gold particles across different membrane compartments using rigorous counting methods

  • Functional consequence assessment:

    • Compare wild-type VAMP4 with targeting-deficient mutants in rescue experiments of VAMP4 KO neurons

    • Measure effects on synaptic vesicle release probability and facilitation

    • Analyze changes in the size and dynamics of synaptic vesicle pools

These approaches will provide comprehensive insights into the molecular mechanisms and functional significance of VAMP4's targeting to endolysosomal compartments during neuronal activity.

How should researchers interpret conflicting data on VAMP4 localization across different experimental systems?

When faced with conflicting data on VAMP4 localization across different experimental systems, researchers should apply a systematic analytical approach:

  • Methodological considerations:

    • Compare fixation and preparation techniques, as these can significantly affect membrane protein localization

    • Evaluate antibody specificity through appropriate controls (e.g., VAMP4 knockout tissue)

    • Consider the resolution limits of different imaging techniques (light vs. electron microscopy)

  • Quantitative analysis framework:

    • Implement rigorous quantification of VAMP4 distribution across cellular compartments

    • Use defined criteria for compartment identification to ensure consistency

    • Report relative distribution percentages with statistical measures of variability

    CompartmentPercentage of Total Gold Particles ± SD
    TGN~45-50%
    Endosomes~15-20%
    Golgi stack~10-15%
    Vesicles~10-15%
    Other~5-10%
  • Cell type and developmental considerations:

    • Recognize that VAMP4 distribution varies between cell types (neurons vs. epithelial cells)

    • Within neurons, distribution differs between cell bodies and synaptic terminals

    • Consider developmental stage, as VAMP4 expression and localization may change during neuronal maturation

  • Resolution through complementary approaches:

    • Combine subcellular fractionation with microscopy data

    • Use live-cell imaging to complement fixed-cell observations

    • Consider dual-labeling with established compartment markers to resolve ambiguities

  • Biological interpretation:

    • Recognize that apparent conflicts may reflect the dynamic nature of VAMP4 trafficking

    • Consider that VAMP4 may cycle between compartments, with distribution reflecting steady-state rather than exclusive localization

    • Evaluate whether experimental manipulations (e.g., overexpression) might alter normal distribution patterns

By systematically addressing these factors, researchers can reconcile apparently conflicting data and develop a more comprehensive understanding of VAMP4's dynamic localization patterns.

What statistical approaches are most appropriate for analyzing VAMP4 knockout phenotypes?

  • Selection based on data distribution:

    • For normally distributed data: Student's t-test (two-tailed) and analyses of variance (ANOVAs) followed by Tukey's post hoc test

    • For non-Gaussian datasets: Mann-Whitney (two-tailed), Wilcoxon matched-pairs signed-rank (two-tailed), and Kruskal-Wallis with Dunn's post hoc tests

    • Verify normality assumptions before selecting parametric tests

  • Analysis of complex experimental designs:

    • For experiments with multiple factors: Two-way ANOVA to determine genotype effects and interactions for multigroup comparisons

    • For repeated measurements: Mixed-effects models that account for both fixed effects (genotype) and random effects (individual variation)

    • For rescue experiments: One-way ANOVA with multiple comparison corrections to compare KO, WT, and KO+rescue conditions

  • Specialized analyses for electrophysiology and imaging data:

    • For release probability calculations: Normalize first evoked EPSC amplitude by the effective readily releasable pool size

    • For synaptic facilitation/depression: Repeated measures ANOVA on normalized response amplitudes during stimulus trains

    • For fluorescence responses: Area under curve measurements with appropriate baseline corrections

  • Reporting requirements:

    • Include specific information about sample sizes

    • Document statistical tests used to calculate p-values

    • Report the numeric values of results

    • Use standardized significance notation (* p < 0.05, ** p < 0.01, *** p < 0.001, **** p < 0.0001)

  • Advanced multivariate approaches for proteomic data:

    • Principal component analysis for dimensionality reduction

    • Volcano plots showing both statistical significance and fold change

    • Filtering using both p-value thresholds (<0.05) and fold change cutoffs (≥1.5)

Implementing these statistical approaches will ensure robust analysis of VAMP4 knockout phenotypes across different experimental paradigms and data types.

How might recombinant VAMP4 be used to develop novel approaches for studying synaptic plasticity?

Recombinant VAMP4 offers several promising applications for developing innovative approaches to study synaptic plasticity:

  • Optogenetic control of release probability:

    • Engineer light-sensitive VAMP4 variants that can be targeted to or removed from synaptic vesicles upon optical stimulation

    • This would allow precise spatial and temporal control of release probability at specific synapses

    • Such tools could help dissect the role of release probability in different forms of synaptic plasticity

  • Molecular sensors of trafficking pathways:

    • Develop FRET-based sensors using VAMP4 and its binding partners to monitor SNARE complex formation in real-time

    • Create split-fluorescent protein constructs that report on VAMP4 engagement with endolysosomal sorting machinery

    • These approaches would provide new insights into activity-dependent trafficking events underlying synaptic plasticity

  • Targeted manipulation of presynaptic facilitation:

    • Given VAMP4's role in controlling short-term facilitation , design peptides or small molecules that modulate VAMP4-dependent regulation of release probability

    • Such tools could selectively enhance or suppress specific forms of short-term plasticity

    • This could have applications in studying learning and memory processes that depend on particular patterns of synaptic facilitation

  • Quantitative proteomics applications:

    • Use SILAC or TMT labeling combined with VAMP4 immunoprecipitation to identify activity-dependent changes in the VAMP4 interactome

    • Apply cross-linking mass spectrometry to map structural relationships within VAMP4-containing complexes

    • These approaches would reveal molecular mechanisms underlying activity-dependent regulation of release probability

  • Circuit-specific manipulation:

    • Develop viral vectors for cell-type-specific expression of modified VAMP4 variants

    • Create conditional VAMP4 knockout models to assess circuit-specific functions

    • These tools would allow investigation of how VAMP4-dependent plasticity mechanisms contribute to specific neural circuit functions

These innovative approaches leveraging recombinant VAMP4 would significantly advance our understanding of the molecular mechanisms underlying synaptic plasticity and potentially lead to new therapeutic strategies for neurological disorders.

What are the current challenges and future directions in VAMP4 research?

Current challenges and future directions in VAMP4 research span multiple levels of investigation:

  • Structural dynamics challenges:

    • Obtaining high-resolution structures of VAMP4 in different conformational states

    • Understanding the structural basis for VAMP4's lower efficiency in SNARE complex formation compared to syb2

    • Future direction: Apply cryo-electron microscopy to resolve VAMP4-containing SNARE complexes in different functional states

  • Regulatory mechanism questions:

    • Identifying the precise molecular signals that direct VAMP4 to endolysosomes during activity

    • Understanding how VAMP4 targeting is regulated in different synapse types

    • Future direction: Comprehensive mapping of post-translational modifications on VAMP4 and their functional consequences

  • Physiological function gaps:

    • Determining the exact relationship between VAMP4 levels and synaptic vesicle release probability across diverse synapse types

    • Understanding how VAMP4-dependent plasticity mechanisms contribute to learning and memory

    • Future direction: Develop behavioral paradigms in conditional VAMP4 knockout models to link molecular function to cognitive processes

  • Methodological limitations:

    • Current challenges in simultaneously tracking VAMP4 trafficking and measuring release probability at individual synapses

    • Difficulty distinguishing direct VAMP4 effects from secondary consequences of altered trafficking

    • Future direction: Develop super-resolution imaging approaches combined with electrophysiology to correlate VAMP4 dynamics with functional outcomes

  • Translational research opportunities:

    • Exploring how VAMP4 dysfunction might contribute to neurological disorders involving synaptic dysregulation

    • Investigating whether VAMP4-dependent mechanisms could be therapeutic targets

    • Future direction: Screen for compounds that modulate VAMP4 trafficking or function as potential neurotherapeutics

Addressing these challenges will require interdisciplinary approaches combining advanced structural biology, proteomics, electrophysiology, and behavioral neuroscience. Progress in these areas will significantly enhance our understanding of the fundamental mechanisms underlying synaptic transmission and plasticity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.