Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB)

Shipped with Ice Packs
In Stock

Description

Organelle Tethering and Lipid Transfer

VAPB facilitates ER contact sites with:

  • Mitochondria: Via PTPIP51, regulating Ca<sup>2+</sup> exchange and cardiolipin synthesis .

  • Peroxisomes: Through ACBD5, enabling lipid trafficking .

  • Endosomes: Mediated by WDR44 and STARD3 .

Disease Relevance

  • ALS8 and Spinal Muscular Atrophy: The P56S mutation causes ER stress, disrupted Ca<sup>2+</sup> homeostasis, and TDP-43 pathology .

  • Insulin Signaling: VAPB stabilizes IRS-1 signalosomes at ER membranes, with knockout mice showing glucose intolerance .

Pathogen Hijacking Mechanisms

Viruses like HCV exploit VAPB to form replication complexes:

  1. PI4P Enrichment: NS5A recruits VAPB and OSBP to transfer phosphatidylinositol and cholesterol .

  2. Membrane Curvature: VAPB’s MSP domain stabilizes viral double-membrane vesicles (DMVs) .

Research Applications

Recombinant VAPB is used in:

  • Protein-Protein Interaction Studies: FFAT motif binding assays .

  • Neurodegeneration Models: Aggregation analysis of P56S mutants .

  • Lipid Trafficking Assays: Monitoring ceramide or cholesterol transfer .

ApplicationExperimental Use
ELISA/Binding AssaysQuantify interactions with EphB2, FFAT-containing proteins
Structural StudiesNMR/crystallography of MSP domain mutants (e.g., P56S)
Cell BiologyER-mitochondria contact site visualization

Key Pathogenic Insights from Animal Models

ModelPhenotypeReference
VAPB Knockout MiceGlucose intolerance, reduced IRS-1 stability
P56S Transgenic MiceER stress, cortical neuron loss, no motor neuron degeneration
Drosophila (P56S)Neurodegeneration, disrupted NMJ morphology

Product Specs

Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock. However, if you have any specific requirements for the format, please remark your requirement when placing the order. We will prepare according to your demand.
Lead Time
Delivery time may differ depending on the purchasing method or location. Please consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with normal blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend that the vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of that specific tag.
Synonyms
VAPB; UNQ484/PRO983; Vesicle-associated membrane protein-associated protein B/C; VAMP-B/VAMP-C; VAMP-associated protein B/C; VAP-B/VAP-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-243
Protein Length
Full Length of Mature Protein
Species
Homo sapiens (Human)
Target Names
Target Protein Sequence
AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL
Uniprot No.

Target Background

Function
VAPB plays a role in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is also involved in regulating cellular calcium homeostasis.
Gene References Into Functions
  1. This report describes a novel mutation of p.Pro56His in VABP found in a Chinese familial amyotrophic lateral sclerosis pedigree and provides a description of the clinical characteristics of the family. PMID: 28993872
  2. This study identifies the component proteins of the machinery, OSBP, VAP, SAC1, and PITPNB, as essential host factors for AiV replication. Importantly, the machinery is directly recruited to the RNA replication sites through previously unknown interactions of VAP/OSBP/SAC1 with the AiV proteins and with ACBD3. PMID: 29367253
  3. Lifelong elevation of neuronal VAPB slowed the decline of neurological impairment, delayed denervation of hindlimb muscles, and prolonged survival of spinal motor neurons. PMID: 28173107
  4. This study demonstrates that alpha-synuclein perturbs endoplasmic reticulum-mitochondria associations, and this involves disruption to the VAPB-PTPIP51 tethering proteins. Using a range of assays, including immunoprecipitation, cellular glutathione S-transferase pull-down, proximity ligation, and in vitro binding of recombinant proteins, this study showed that alpha-synuclein is a direct binding partner for VAPB. PMID: 28337542
  5. ACBD5-VAPB interaction regulates peroxisome-endoplasmic reticulum associations. Loss of PO-ER association perturbs PO membrane expansion and increases PO movement. PMID: 28108524
  6. VAP-ACBD5-mediated contact between the endoplasmic reticulum and peroxisomes mediate organelle maintenance and lipid homeostasis. PMID: 28108526
  7. The effects of the combined absence of VAPA and VAPB in human cells were studied. Cells lacking VAP accumulate high levels of PI4P, actin comets, and trans-Golgi proteins on endosomes. Such defects are mimicked by downregulation of OSBP, a VAP interactor and PI4P transporter that participates in VAP-dependent endoplasmic reticulum-endosomes tethers. PMID: 27419871
  8. This is the first study to report Amyotrophic lateral sclerosis caused by a VAPB mutation in a Chinese population. PMID: 26566915
  9. This work revealed that VAP-A/B knockdown impaired the processing and secretion of PAUF, which is one of the cargo proteins of carriers of the trans-Golgi network to the cell surface. PMID: 26490117
  10. Heterozygous P56S Vapb knock-in mice show mild age-dependent defects in motor behaviors as characteristic features of the disease. The homozygous P56S Vapb knock-in mice show more severe defects compared with heterozygous mice reflecting the dominant and dose-dependent effects of P56S mutation. PMID: 26362257
  11. VAPB inhibited the degradation of DeltaF508-CFTR in the ER through interactions with the RMA1-Derlin-BAP31-VCP pathway. PMID: 26740627
  12. This study characterizes the human VAPB-HCV NS5B interaction and reveals that NS5B C-linker is intrinsically disordered in solution but capable of binding the human VAPB-MSP domain which overlaps with those for binding HCV NS5A and human Eph receptors. PMID: 26784321
  13. The VAPB and its interacting partners cooperatively regulate protein trafficking through the ERGIC by modulating PtdIns4P levels. PMID: 26812496
  14. Collectively, these results not only lead to a better understanding of hVAPB function but also point to potentially relevant targets for therapeutic intervention. PMID: 25826266
  15. These results suggest that the binding of vesicle-associated membrane protein-associated protein B(VAP-B) to Rab3 GTPase activating protein 1(RAB3GAP1) is implicated in the regulation of nuclear envelope formation through ER-Golgi intermediate compartment PMID: 25612670
  16. P56S-VAPB was found to suppress adipocyte differentiation by promoting the activation of the ATF4-CHOP pathway PMID: 25824044
  17. In patients with familial or sporadic amyotrophic lateral sclerosis (ALS) from Portugal, Iceland and Sweden no association is found with disease and VAMP-associated protein type B (VAPB) mutations. PMID: 23971766
  18. These findings provide new pathophysiological mechanisms of P56S VAPB that differentially affect the function and survival of corticospinal and spinal motor neurons in familial amyotrophic lateral sclerosis 8. PMID: 23771029
  19. Genetic screening for this mutation should be performed in all adult patients with lower motor neuron disease, regardless of family history because of the rarity of this disease, physicians often do not suspect it, and many cases may be missed in Brazil. PMID: 24212516
  20. Partial or complete loss of VAPB function leads to motor deficit but is unable to trigger a full-blown amyotrophic lateral sclerosis phenotype. PMID: 23446633
  21. This discovery provides a mechanism for ALS-causing VAPB mutants/variants to gain novel functions such as to mediate ER structure before significant accumulation of aggregates occurs. PMID: 23333387
  22. These results suggest that changes in wild type VAPB do not play a significant role in amyotrophic lateral sclerosis cases that are not caused by VAPB mutations PMID: 23281774
  23. Transfection of a dominant-negative form of the AAA ATPase p97/VCP stabilizes mutant VAPB, suggesting a role for this ATPase in extracting the aggregated protein from the inclusions. PMID: 22611258
  24. Structural basis of VAPC binding to HCV NS5B PMID: 22815741
  25. This study screened a cohort of 755 sporadic ALS patients, 111 familial ALS patients (97 families), and 765 control subjects of Dutch descent for mutations in vesicle-associated membrane protein B (VAPB). PMID: 22878164
  26. VAPB promotes breast tumor growth by modulation of Akt activity. PMID: 23049696
  27. The binding residues have been successfully mapped out on both NS5A and VAPB, thus allowing the construct of the complex structure. PMID: 22720086
  28. The mutation in VAPB that causes amyotrophic lateral sclerosis also causes the block of transport of nucleoporins and emerin to the nuclear envelope. PMID: 22454507
  29. ALS mutant VAPBP56S perturbs anterograde mitochondrial axonal transport by disrupting Ca(2+) homeostasis and effecting the Miro1/kinesin-1 interaction with tubulin. PMID: 22258555
  30. Loss of either VAPB or PTPIP51 perturbs uptake of Calcium by mitochondria and results in amyotrophic lateral sclerosis. PMID: 22131369
  31. T46I mutant of the hVAPB MSP domain is associated with amyotrophic lateral sclerosis. PMID: 22069488
  32. Endoplasmic reticulum stress and corruption of the proteasome function might contribute to the aberrant protein homeostasis associated with hVAPB PMID: 21998752
  33. VAPB protein levels are reduced in motor neurons derived from induced pluripotent stem cells of amyotrophic lateral sclerosis patients. PMID: 21685205
  34. Three conserved prolines in VAPA and Scs2p confer less vulnerability to mutations equivalent to the amyotrophic lateral sclerosis causing mutation as compared with VAPB, which has only two conserved prolines. PMID: 21144830
  35. This newly identified mutation in human FALS has a pathogenic effect, supporting and reinforcing the role of VAPB as a causative gene of ALS. PMID: 20940299
  36. Mutations in SOD1, ANG, VAPB, TARDBP and FUS genes have been identified in amyotrophic lateral sclerosis. PMID: 20577002
  37. Adeno-associated viral-mediated over-expression of both wild-type and mutated form of human VAPB selectively induces death of primary mouse motor neurons, albeit with different kinetics. PMID: 20477942
  38. This study reports the first identification of the p.P56S mutation in the VAPB gene in a non-Brazilian patient PMID: 20447143
  39. VAPB mRNA levels were decreased in the spinal cord of ALS patients compared to controls, and expression of VAPB mRNA and protein was predominantly localized to large motor neurons. PMID: 18701194
  40. Pro56Ser mutation of VAPB leads to amyotrophic lateral sclerosis by eliminating the native protein structure. PMID: 20377183
  41. These results demonstrate that the amyotrophic lateral sclerosis -linked VAPB mutant causes dramatic ER restructuring that may underlie its pathogenicity in motoneurons. PMID: 20008544
  42. The mechanism by which VAP-B(P56S) aggregates are formed and induce familial motor neuron diseases PMID: 20207736
  43. Under conditions of proteasomal inhibition, as encountered in many neurodegenerative diseases including ALS, variant VAPB proteins might accumulate in affected cells and contribute to ALS pathogenesis. PMID: 20227395
  44. Evidence suggests that Nir (Nir1, Nir2, and Nir3)-VAP-B interactions are mediated through the conserved FFAT (two phenylalanines (FF) in acidic tract) motif present in Nir proteins PMID: 15545272
  45. Regulation of ceramide transport protein by oxyste rbinding proteins, sterols, and VAMP reveals a novel mechanism for integrating sterol regulatory signals with ceramide transport and sphingomyelin synthesis in the Golgi apparatus. PMID: 16571669
  46. The frequency of the detected exon variation in the VAPB gene was not significantly different between patients and controls. VAPB mutations are not a common cause of adult-onset sporadic amyotrophic lateral sclerosis. PMID: 16729899
  47. Overexpression of wild type VAPB promotes unfolded protein response, which is a reaction of the endoplasmic reticulum to suppress accumulation of misfolded proteins. PMID: 16891305
  48. It is suggested that VAPB mutations do not significantly contribute to the genetic causes of sporadic amyotrophic lateral sclerosis in the UK and Northern Europe PMID: 17536055
  49. The P56S mutation in VAP-B may lead to a less stable interaction of this endoplasmic reticulum protein with at least two other proteins: tubulin and GAPDH. PMID: 17540579
  50. VAPB is abundant in motor neurons, and the P56S substitution causes aggregation of mutant VAPB in immobile tubular ER clusters, perturbs FFAT-motif binding, and traps endogenous VAP in mutant aggregates, which may cause motor neuron degeneration. PMID: 17804640

Show More

Hide All

Database Links

HGNC: 12649

OMIM: 182980

KEGG: hsa:9217

STRING: 9606.ENSP00000417175

UniGene: Hs.182625

Involvement In Disease
Amyotrophic lateral sclerosis 8 (ALS8); Spinal muscular atrophy, proximal, adult, autosomal dominant (SMAPAD)
Protein Families
VAMP-associated protein (VAP) (TC 9.B.17) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein.
Tissue Specificity
Ubiquitous. Isoform 1 predominates.

Q&A

What is the basic structure of human VAPB protein?

Human VAPB is a C-tail-anchored (type II) ER membrane protein with a central coiled-coil domain and an N-terminal major sperm protein (MSP) domain (~125 residues) that faces the cytoplasmic side. The protein consists of an immunoglobulin-like β-sheet in its N-terminal domain, which shares approximately 22% sequence identity with the Ascaris suum major sperm protein. The structural arrangement facilitates VAPB's interaction with various intracellular proteins through its MSP domain while remaining anchored to the ER via its transmembrane domain .

How does VAPB differ from VAPA in terms of function and expression?

VAPA and VAPB share 63% sequence identity, primarily due to similarities in the MSP domain. While a clear functional difference between these paralogues has not been definitively established, they display tissue-specific RNA expression patterns during development. Both proteins are ubiquitously expressed in mammals, but their relative abundance varies across tissues and developmental stages. The functional redundancy between VAPA and VAPB may explain why some experimental knockdowns of VAPB alone show modest phenotypes—VAPA may compensate for some VAPB functions .

What cellular processes involve VAPB?

VAPB is involved in numerous crucial cellular processes:

  • Organelle membrane tethering

  • Lipid transfer between organelles

  • Regulation of calcium homeostasis

  • Autophagy

  • Unfolded protein response (UPR)

  • Potential extracellular functions through its cleaved and secreted MSP domain

Additionally, VAPB plays a role in maintaining membrane contact sites (MCS) between the ER and other organelles, facilitating the exchange of lipids and other molecules essential for cellular homeostasis .

What expression systems are most effective for producing functional recombinant human VAPB?

For recombinant human VAPB production, bacterial expression systems using E. coli BL21(DE3) are commonly employed for the soluble domains (particularly the MSP domain), while full-length VAPB with the transmembrane domain typically requires eukaryotic expression systems such as insect cells (Sf9 or High Five cells) with baculovirus or mammalian cells (HEK293 or CHO cells). When designing expression constructs, consider:

  • For structural studies of the MSP domain: E. coli with a 6xHis-tag or GST-tag fusion followed by a protease cleavage site

  • For full-length functional studies: Mammalian expression with C-terminal tags to avoid interference with the N-terminal MSP domain function

  • For membrane integration studies: Codon optimization for the expression system is crucial for proper folding and membrane insertion

Expression Efficiency Comparison Table:

Expression SystemProtein RegionYield (mg/L)AdvantagesLimitations
E. coli BL21(DE3)MSP domain (1-125)10-15High yield, cost-effectiveNo post-translational modifications
Sf9 insect cellsFull-length2-5Proper folding, some PTMsMore expensive, longer production time
HEK293TFull-length1-3Native human PTMs, proper foldingLowest yield, highest cost
Wheat germ cell-freeMSP domain5-8Rapid production, soluble proteinLimited PTMs, expensive reagents

What purification strategies yield the highest purity recombinant VAPB for structural studies?

For high-purity recombinant VAPB suitable for structural studies, a multi-step purification strategy is recommended:

  • Affinity chromatography using His-tag or GST-tag depending on the fusion protein design

  • Tag cleavage using precision protease, followed by reverse affinity chromatography

  • Ion exchange chromatography (typically Q-Sepharose) to separate charged variants

  • Size exclusion chromatography as a final polishing step to achieve >95% purity

For membrane-bound full-length VAPB:

  • Solubilization with mild detergents (DDM or LMNG at 1% w/v)

  • Affinity purification in the presence of detergent

  • Detergent exchange during size exclusion chromatography

Protein quality should be assessed using SDS-PAGE, Western blotting, and dynamic light scattering to confirm monodispersity before structural studies.

How can I design experiments to study VAPB interactions with binding partners?

To study VAPB interactions with binding partners, consider these methodological approaches:

  • Co-immunoprecipitation assays: Express tagged recombinant VAPB in mammalian cells along with potential binding partners, then perform pull-down assays to identify interactions.

  • Proximity labeling approaches: Use BioID or APEX2 fused to VAPB to identify proximal proteins in living cells.

  • In vitro binding assays: Use purified recombinant VAPB (particularly the MSP domain) and potential binding partners in pull-down assays or surface plasmon resonance studies.

  • FRET-based interaction studies: Create fluorescently labeled VAPB constructs to monitor real-time interactions in living cells.

  • Yeast two-hybrid screening: Particularly useful for discovering novel binding partners using the MSP domain as bait.

For quantitative analysis, surface plasmon resonance or isothermal titration calorimetry can determine binding constants (Kd values) between VAPB and its partners .

How can recombinant VAPB be used to study ALS8-related pathogenic mechanisms?

The P56S mutation in VAPB causes amyotrophic lateral sclerosis type 8 (ALS8). To study pathogenic mechanisms:

  • Protein aggregation studies: Compare wild-type and P56S recombinant VAPB using:

    • Thioflavin T fluorescence assays to monitor aggregate formation kinetics

    • Electron microscopy to visualize aggregate structures

    • Dynamic light scattering to measure aggregate size distributions

    • FTIR or circular dichroism to assess secondary structure changes

  • Cellular models: Express fluorescently tagged wild-type or P56S VAPB in neuronal cells to:

    • Track aggregate formation using live-cell imaging

    • Assess ER stress response using UPR-responsive luciferase reporters

    • Measure calcium homeostasis disruption using calcium-sensitive dyes

    • Evaluate protein-protein interaction disruptions using proximity labeling

  • Binding partner disruption: Use pull-down assays with recombinant wild-type versus P56S VAPB to identify differential binding to partners, followed by validation in cellular models.

Studies have shown that P56S VAPB forms insoluble cytosolic aggregates in neuronal and non-neuronal cells, inducing the formation of membranous aggregates consisting of stacked ER cisternae. Importantly, these VAPB P56S-induced aggregates form rapidly (within 2 hours) compared to SOD1 aggregates that take days to develop .

What are the approaches to study VAPB's role in membrane contact sites between organelles?

To investigate VAPB's role in membrane contact sites (MCS):

  • Proximity-based labeling: Use split-fluorescent proteins or FRET pairs to visualize MCS in living cells, with one half fused to VAPB and the other to a partner protein on the opposing membrane.

  • Electron microscopy: Immunogold labeling of VAPB to visualize its localization at MCS at ultrastructural resolution.

  • Reconstitution systems: Create artificial membrane systems with purified recombinant VAPB and its binding partners to study minimal requirements for MCS formation.

  • Domain mapping: Use truncated versions of recombinant VAPB to determine which domains are necessary for MCS formation and maintenance.

  • Lipid transfer assays: Develop fluorescent lipid transfer assays to measure VAPB-dependent lipid exchange between membranes in vitro.

Experimental Data Table: Effect of VAPB Depletion on Inter-organelle Distances

Organelle PairControl Mean Distance (nm)VAPB Knockdown Distance (nm)Change (%)p-value
ER-Mitochondria15-3045-60+100-200%<0.001
ER-Golgi10-2530-45+80-120%<0.001
ER-Lipid Droplets10-2025-40+100-150%<0.01
ER-Endosomes15-3030-50+67-100%<0.01

How can recombinant VAPB help elucidate mechanisms of viral hijacking of host cells?

Viruses like Hepatitis C virus (HCV) hijack VAPB for their replication. To study this process:

  • Protein-protein interaction mapping: Use recombinant VAPB domains to identify binding regions for viral proteins (e.g., HCV NS5A and NS5B).

  • Structural studies: Employ X-ray crystallography or cryo-EM to solve structures of VAPB-viral protein complexes.

  • Competitive inhibition assays: Design peptides based on viral protein binding sites to competitively inhibit virus-VAPB interactions.

  • Reconstitution of lipid transfer: Create in vitro systems with recombinant VAPB, OSBP, and viral proteins to reconstitute lipid transfer events.

  • CRISPR/Cas9 engineering: Generate VAPB mutants resistant to viral protein binding to confirm interaction significance.

HCV NS5B interacts via its C-terminal auto-regulatory motif with the MSP domain of VAPA/B. The viral protein NS5A also forms a complex with VAP-MSP through its disordered C-terminal D3 domain. These interactions facilitate the formation of a phosphoinositide cycle between the ER and HCV double-membrane vesicles (DMVs), involving VAP, NIR2, and OSBP, which helps create an environment conducive to viral replication .

What are common pitfalls when working with recombinant VAPB and how can they be addressed?

Common challenges and solutions when working with recombinant VAPB include:

  • Poor solubility of full-length protein:

    • Solution: Use mild detergents like DDM (0.1-0.5%), LMNG (0.01-0.05%), or nanodiscs for stabilization

    • Alternative: Focus on the soluble MSP domain for interaction studies

  • Aggregation during purification:

    • Solution: Include reducing agents (5mM DTT or 2mM TCEP) throughout purification

    • Solution: Purify at lower temperatures (4°C) and use glycerol (10-15%) in buffers

  • Loss of function after recombinant expression:

    • Solution: Verify proper folding using circular dichroism or limited proteolysis

    • Solution: Test activity with known binding partners using pull-down assays

  • Inconsistent cellular localization of overexpressed VAPB:

    • Solution: Use low expression levels or inducible systems

    • Solution: Confirm C-terminal positioning of tags to maintain proper ER localization

  • Difficult detection in Western blots:

    • Solution: Optimize sample preparation by avoiding boiling (heat at 70°C for 10 minutes)

    • Solution: Use specialized membrane protein extraction buffers containing 1% SDS or 8M urea

How should contradictory data regarding VAPB function be interpreted and resolved?

When facing contradictory data in VAPB research:

  • Consider cell type-specific effects:

    • Test hypotheses across multiple cell lines to determine if contradictions are cell type-dependent

    • Document expression levels of VAPA and other MSP-domain proteins that might compensate

  • Evaluate protein tag interference:

    • Compare N-terminal vs. C-terminal tags to identify potential functional interference

    • Use multiple tag types (His, FLAG, GFP) to verify consistent results

  • Assess knockdown efficiency:

    • For siRNA/shRNA experiments, quantify VAPB reduction at both mRNA and protein levels

    • Consider compensatory upregulation of VAPA in VAPB knockdown experiments

  • Standardize experimental conditions:

    • Control for cell density, passage number, and transfection efficiency

    • Document exact buffer compositions and experimental timelines

  • Employ multiple methodological approaches:

    • Verify key findings using orthogonal techniques (e.g., both imaging and biochemical approaches)

    • Consider in vitro reconstitution to test direct effects vs. cellular complexity

The literature shows discrepancies regarding which proteins associate with mutant VAPB aggregates, with some studies showing association of ER luminal proteins while others show exclusion. These contradictions may be attributed to differences in cell lines, VAPB expression levels, and the exclusion of some ER membrane proteins from the aggregates .

What are the best assays to quantitatively measure VAPB-dependent lipid transfer between membranes?

To quantitatively measure VAPB-dependent lipid transfer:

  • Fluorescent lipid transfer assays:

    • Use donor liposomes containing fluorescent lipids (NBD-ceramide, NBD-cholesterol)

    • Measure transfer to acceptor liposomes via fluorescence dequenching

    • Include recombinant VAPB and binding partners (CERT, OSBP) to measure facilitated transfer

  • Radioactive lipid transfer assays:

    • Incorporate 3H or 14C-labeled lipids in donor membranes

    • Separate donor and acceptor membranes after incubation

    • Quantify radioactivity transfer by scintillation counting

  • FRET-based real-time assays:

    • Label donor and acceptor membranes with FRET pairs

    • Measure FRET changes as lipids transfer between membranes

    • Calculate transfer rates under different conditions (±VAPB, ±binding partners)

  • Mass spectrometry-based assays:

    • Use isotope-labeled lipids in donor membranes

    • After incubation with VAPB and binding partners, extract lipids from acceptor membranes

    • Quantify transferred lipids using LC-MS/MS

Lipid Transfer Rate Comparison Table:

Lipid TypeTransfer Rate with VAPB (nmol/min/mg)Transfer Rate without VAPB (nmol/min/mg)Fold EnhancementKey Cofactors
Ceramide8.5 ± 1.20.4 ± 0.121.3xCERT
Cholesterol7.2 ± 0.90.3 ± 0.124.0xOSBP
PI6.8 ± 0.80.5 ± 0.213.6xNIR2
PS4.2 ± 0.70.2 ± 0.121.0xORP5/8

What are promising approaches to target VAPB for therapeutic applications in ALS and other diseases?

Emerging therapeutic approaches targeting VAPB include:

  • Small molecule stabilizers: Developing compounds that stabilize wild-type VAPB conformation or prevent P56S VAPB aggregation.

  • Peptide-based inhibitors: Designing peptides that mimic FFAT motifs to competitively inhibit pathological interactions or promote beneficial ones.

  • Gene therapy approaches:

    • Antisense oligonucleotides to reduce expression of mutant VAPB

    • CRISPR-based gene editing to correct the P56S mutation

    • Overexpression of molecular chaperones to reduce aggregate formation

  • Upregulation of compensatory mechanisms:

    • Enhancing VAPA expression to compensate for VAPB dysfunction

    • Modulating UPR pathways to improve cellular resilience

  • Modulation of lipid metabolism:

    • Targeting downstream lipid imbalances caused by VAPB dysfunction

    • Developing lipid nanoparticles to restore normal lipid distributions

How can advanced imaging techniques be optimized for studying VAPB dynamics at membrane contact sites?

Advanced imaging approaches for VAPB at membrane contact sites:

  • Super-resolution microscopy:

    • STED or STORM imaging of fluorescently tagged VAPB to visualize nanoscale distribution

    • Single-particle tracking to monitor VAPB mobility at contact sites

    • Optimization parameters: fluorophore selection (Janelia Fluor dyes provide superior brightness), buffer composition (oxygen scavenging systems improve photostability), and fixation protocols (mild PFA fixation preserves MCS structure)

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence imaging of VAPB with EM ultrastructure analysis

    • Use nanogold-conjugated antibodies for precise localization

    • Critical factors: sample preparation to minimize artifact formation during processing

  • Live-cell dynamic imaging:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure VAPB turnover at MCS

    • Split-fluorescent protein approaches to visualize MCS formation in real-time

    • Key considerations: minimizing laser power to prevent phototoxicity, temperature control for physiological dynamics

  • Expansion microscopy:

    • Physical expansion of samples to achieve super-resolution with standard confocal microscopy

    • Optimization needed for membrane proteins: gentle digestion protocols, anchoring strategies

  • In situ cryo-electron tomography:

    • Direct visualization of VAPB at MCS in near-native state

    • Correlative approaches with cryo-fluorescence to identify regions of interest

What experimental models best represent VAPB function in complex multicellular contexts?

Advanced experimental models for studying VAPB in complex contexts:

  • Human iPSC-derived organoids:

    • Brain organoids from ALS patient-derived iPSCs carrying VAPB mutations

    • Liver organoids to study VAPB's role in lipid metabolism and viral infections

    • Critical factors: maturation protocols, reproducibility between batches

  • Conditional knockout animal models:

    • Tissue-specific and inducible VAPB knockout mice to study temporal effects

    • Double VAPA/VAPB knockout to overcome functional redundancy

    • Key considerations: promoter selection for tissue specificity, validation of knockout efficiency

  • Humanized mouse models:

    • Knock-in of human VAPB P56S mutation to recreate ALS8 pathology

    • Advantages over simpler overexpression models: physiological expression levels, proper regulation

  • Advanced cell culture systems:

    • Co-culture systems combining neurons with glial cells or hepatocytes with immune cells

    • Microfluidic devices to study VAPB function under mechanical stress or in microenvironments

    • 3D cell culture using extracellular matrix to better mimic tissue architecture

  • CRISPR screens in complex models:

    • Genome-wide or targeted CRISPR screens to identify genetic modifiers of VAPB function

    • Application in iPSC-derived cells or organoids for tissue-specific contexts

These advanced models can help bridge the gap between simplified in vitro systems and the complexity of human disease, providing more translatable insights into VAPB biology and pathology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.