Recombinant Human Vesicle-trafficking protein SEC22a (SEC22A)

Shipped with Ice Packs
In Stock

Description

Functional Role in Vesicle Trafficking

SEC22A acts as a v-SNARE protein critical for ER-to-Golgi transport and membrane fusion . It interacts with t-SNAREs (e.g., BET1, GOSR1, STX5) to mediate vesicle docking and fusion . Key roles include:

  • Anterograde Transport: Facilitates cargo movement from ER to Golgi via COPII vesicles .

  • Retrograde Transport: Participates in Golgi-to-ER retrieval, ensuring membrane recycling .

  • Homodimer Formation: Enhances membrane fusion efficiency by stabilizing SNARE complexes .

Expression and Production

Recombinant SEC22A is produced via heterologous systems:

SystemTagApplicationsAdvantagesSource
HEK-293Myc-DYKDDDDKAntibody production, ELISA standardsNative conformation, post-translational modifications
E. coliN-terminal HisHigh-yield production, structural studiesCost-effective, scalable purification

Protein Interactions and Complexes

SEC22A interacts with multiple trafficking proteins to form functional SNARE complexes:

PartnerRoleInteraction ScoreSource
BET1t-SNARE for ER-derived vesicle docking at cis-Golgi0.995
GOSR2Mediates cis/medial-Golgi to trans-Golgi network transport0.992
STX5Syntaxin-5; stabilizes Golgi structure and vesicle tethering0.991
YKT6V-SNARE for endosome-to-TGN transport; functional redundancy with SEC22A0.946

Applications in Research

Recombinant SEC22A is widely used in:

  • Antibody Production: Serves as a native antigen for generating SEC22A-specific antibodies .

  • ELISA/Western Blot: Standard controls for quantifying SEC22A in cell lysates or tissues .

  • Membrane Fusion Studies: Model system to investigate SNARE-mediated vesicle docking .

Gene Interactions and Regulatory Insights

SEC22A (gene symbol: SEC22A) is located at 3q21.1 and interacts with chemicals and pathways affecting its expression:

ChemicalEffectSource
Valproic AcidAlters methylation and splicing; increases mRNA
EpigallocatechinReduces mRNA levels in combination with potassium chromate
EthanolDecreases mRNA expression

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SEC22A; SEC22L2; Vesicle-trafficking protein SEC22a; SEC22 vesicle-trafficking protein homolog A; SEC22 vesicle-trafficking protein-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SEC22A
Target Protein Sequence
MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNI NFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ RTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISS AHQRLEPATLSGIVGFILSLLCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLGTAACLY QCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDYDV
Uniprot No.

Target Background

Function
Potentially involved in vesicle trafficking between the endoplasmic reticulum (ER) and the Golgi apparatus.
Gene References Into Functions
  1. The 200 kDa crystal structure of Sec22 bound to Sec23/24 reveals that the transport signal is a folded epitope, not a conventional short peptide sequence. PMID: 17499046
Database Links

HGNC: 20260

OMIM: 612442

KEGG: hsa:26984

STRING: 9606.ENSP00000310521

UniGene: Hs.477361

Protein Families
Synaptobrevin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SEC22A and what is its primary cellular function?

SEC22A (SEC22 homolog A, vesicle trafficking protein) is a member of the SEC22 family of proteins that functions primarily in vesicle transport between the endoplasmic reticulum (ER) and the Golgi complex. It belongs to the synaptobrevin family and plays a crucial role in intracellular membrane trafficking pathways .

The protein is characterized by:

  • Gene ID: 26984 (human)

  • Molecular weight: Approximately 34.8 kDa

  • Cellular localization: Primarily associated with membranes of the ER, Golgi, and transport vesicles

Research methodologies for studying its function include localization studies with fluorescently tagged constructs, interaction assays, and functional disruption through genetic methods. When studying SEC22A, researchers should consider its role within the broader context of the vesicular transport machinery rather than as an isolated protein.

How does SEC22A differ from other SEC22 family members?

SEC22A is one of several SEC22 family members, which also include SEC22B (also known as ERS-24). While they share structural similarities, they exhibit distinct cellular functions and expression patterns:

FeatureSEC22ASEC22B
Alternative namesSEC22L2SEC22 Vesicle Trafficking Protein-Like 1
Primary localizationER-Golgi transportER-Golgi transport, plasma membrane
UniProt IDQ96IW7O75396
Distinctive domainsContains SNARE domainContains SNARE domain
Known interactorsLess characterizedBetter characterized, interacts with various SNARE proteins

Research indicates that while SEC22B has been more extensively studied and has established roles in conventional ER-Golgi transport, SEC22A may have more specialized functions. To distinguish between them in experimental contexts, researchers should use highly specific antibodies or tagged constructs and validate with knockout controls .

What are the optimal expression systems for producing recombinant SEC22A protein?

Producing high-quality recombinant SEC22A requires careful consideration of expression systems. Based on research findings:

Expression SystemAdvantagesLimitationsRecommended Applications
HEK293T cellsPost-translational modifications maintained, proper foldingHigher cost, lower yieldFunctional studies, interaction assays
E. coliHigh yield, cost-effectiveLacks post-translational modificationsStructural studies, antibody production

For HEK293T expression, evidence suggests using:

  • C-Myc/DDK tags for purification and detection

  • Purification yields of >50 μg/mL as determined by microplate BCA method

  • Purity >80% as determined by SDS-PAGE and Coomassie blue staining

What methodologies are effective for studying SEC22A localization and trafficking dynamics?

Visualizing SEC22A localization and tracking its movement through cellular compartments requires specialized techniques:

  • Fluorescent protein fusion constructs:

    • mCherry::SEC22 or EGFP::SEC22 fusions allow live-cell imaging of protein dynamics

    • Both N-terminal and C-terminal tagging approaches have been successful, though C-terminal tagging may interfere less with protein function

  • Immunofluorescence microscopy:

    • Fixed-cell imaging using specific anti-SEC22A antibodies

    • Co-staining with markers for cellular compartments (RAB7 for late endosomes, LMP-1 for lysosomes)

  • Live-cell dynamics:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure mobility

    • Photoactivatable GFP fusions to track movement from specific compartments

Research has shown that SEC22 proteins localize primarily to cytoplasmic dots representing transport vesicles, with strong fluorescence in developing structures. When designing localization experiments, researchers should include appropriate controls and co-localization markers to definitively identify the subcellular compartments .

How does SEC22A influence late endosome/multivesicular body (MVB) function and RNA interference pathways?

Recent research has uncovered an unexpected role for SEC22 in RNA interference pathways, mediated through its effects on late endosomes/multivesicular bodies:

Studies in C. elegans demonstrated that:

  • Loss of SEC-22 results in enhanced RNAi efficiency upon ingestion of double-stranded RNA

  • Overexpression of SEC-22 inhibits RNAi in wild-type animals

  • SEC-22 primarily affects RNA import or cell-autonomous RNAi in target cells

  • mCherry::SEC-22 localizes to late endosomes/MVBs, which are enlarged in sec-22 mutants

Mechanistically, SEC-22 appears to reduce RNAi efficiency potentially by:

  • Promoting fusion between late endosomes/MVBs and lysosomes

  • Interacting with late endosome-associated RNA transport protein SID-5

  • Affecting the stability or trafficking of RNAi machinery components

For researchers investigating SEC22A's role in RNAi pathways, both loss-of-function and gain-of-function approaches should be employed, with careful attention to tissue-specific effects. Expression of SEC-22 from different tissue-specific promoters can help determine where it primarily functions in the RNAi pathway .

What protein-protein interactions are crucial for SEC22A function, and how can they be studied?

SEC22A functions through interactions with various proteins in the vesicular trafficking machinery. Key interactions and methods to study them include:

Interacting Protein/ComplexFunctionDetection MethodResearch Findings
SID-5Late endosome-associated RNA transportYeast two-hybrid assayDirect interaction detected, functions in SID-5-dependent manner
GET complex (Get3, Get4, Get5)TA protein insertionCo-immunoprecipitationSEC22 acts as substrate for GET pathway-mediated membrane insertion
SNARE proteinsMembrane fusionIn vitro binding assaysForms SNARE complexes mediating vesicle fusion events
Sgt2Scaffold protein in GET pathwayCo-immunoprecipitationBinds SEC22's transmembrane domain in GET pathway

When studying these interactions, researchers should consider:

  • The transmembrane nature of SEC22A can make co-immunoprecipitation challenging

  • Yeast two-hybrid systems may require modification for membrane proteins

  • Proximity-based methods like BioID or APEX may be more effective for detecting transient interactions

  • In vitro reconstitution of membrane systems may be necessary to study SNARE complex formation

Research has shown that these interactions are often dynamic and regulated by cellular conditions, so experimental design should account for this temporal and spatial regulation .

How can researchers resolve contradictory findings regarding SEC22A localization and function?

Contradictory findings in SEC22A research can arise from several sources:

  • Cell type-specific differences:

    • SEC22A may have distinct localizations and functions in different cell types

    • Resolution approach: Clearly document cell types used and perform comparative studies across multiple cell lines

  • Tag interference:

    • Different tags (GFP, mCherry, FLAG, etc.) may affect protein localization or function

    • Resolution approach: Compare N- and C-terminal tags, use small epitope tags, and validate with untagged protein

  • Expression level artifacts:

    • Overexpression can lead to mislocalization and artificial interactions

    • Resolution approach: Use endogenous tagging approaches (CRISPR/Cas9) or tetracycline-inducible systems for controlled expression

  • Antibody specificity issues:

    • Cross-reactivity with other SEC22 family members

    • Resolution approach: Validate antibodies using knockout controls, use multiple antibodies targeting different epitopes

Research has demonstrated that SEC22 proteins can show different localization patterns depending on expression levels. For example, studies found that SEC22 expression under its own promoter versus overexpression from a constitutive promoter can lead to different phenotypic outcomes in complementation assays .

What are the critical controls for functional studies involving SEC22A knockout or knockdown?

When designing functional studies involving SEC22A disruption, the following controls are essential:

  • Rescue experiments:

    • Reintroduction of wild-type SEC22A should restore normal phenotype

    • Use both native promoter and overexpression constructs to assess dose-dependent effects

    • Example: In sec-22 mutant studies, expressing SEC22 under its own promoter restored normal ascospore pigmentation and germination, while overexpression showed partial complementation

  • Assessment of compensatory mechanisms:

    • Measure expression of other SEC22 family members (SEC22B, SEC22C)

    • Evaluate changes in functionally related proteins

    • Research shows potential compensation by other vesicular trafficking components

  • Validation of knockout/knockdown efficiency:

    • Confirm at both mRNA (RT-qPCR) and protein (Western blot) levels

    • Use multiple siRNAs/shRNAs targeting different regions to rule out off-target effects

  • Phenotypic controls:

    • Compare with knockouts/knockdowns of known interaction partners

    • Include conditions that bypass the pathway involving SEC22A

For phenotypic analyses, researchers should examine multiple parameters including growth rate, vesicular morphology, protein trafficking efficiency, and specific pathway functions like RNAi efficiency. Studies have shown that SEC22 disruption can lead to enlarged late endosomes/MVBs, suggesting a role in maintaining proper vesicle morphology and function .

How is SEC22A implicated in disease mechanisms, and what research approaches can elucidate these connections?

While direct links between SEC22A and human diseases are still emerging, vesicular trafficking defects are implicated in numerous pathologies. Research approaches to investigate SEC22A in disease contexts include:

  • Gene expression analysis in disease tissues:

    • Multiple studies have documented altered SEC22A expression in response to various chemical exposures and disease states

    • In rats, SEC22A expression changes have been documented in response to treatments with compounds like epigallocatechin gallate, dimethylhydrazine, and estradiol

  • Genetic association studies:

    • Analysis of SEC22A variants in patient cohorts

    • Evaluation of SEC22A expression in disease-relevant tissues

  • Functional modeling:

    • Use of patient-derived cells to assess SEC22A localization and function

    • CRISPR/Cas9-mediated introduction of disease-associated variants

  • Pathway analysis:

    • Assessment of SEC22A's role in disease-relevant trafficking pathways

    • Investigation of interactions with known disease-associated proteins

Research indicates that SEC22 proteins' involvement in fundamental cellular processes like vesicular trafficking and potentially RNA interference may have implications for various diseases. The experimental approaches should be tailored to the specific disease context and potential mechanisms involving SEC22A .

What considerations should be made when interpreting SEC22A phenotypes across different model organisms?

Comparative studies of SEC22A across species reveal both conserved and divergent functions:

OrganismGene/Protein NameKey FindingsResearch Applications
HumanSEC22AInvolved in ER-Golgi traffickingDisease modeling, cell biology
RatSec22aRegulated by various chemical exposuresToxicology, drug response
C. elegansSEC-22Functions in late endosome/MVB dynamics and RNAiGenetic screening, RNAi pathway studies
S. macrosporasec22Required for ascospore pigmentation and germinationFungal development studies
S. cerevisiaeSEC22Functions in GET pathway for TA protein insertionMembrane protein biogenesis

When interpreting phenotypes across species, researchers should consider:

  • Evolutionary conservation:

    • Core functions in vesicular trafficking are likely conserved

    • Species-specific adaptations may exist for specialized functions

  • Genetic redundancy:

    • Different organisms may have varying numbers of SEC22 paralogs

    • Compensation mechanisms may differ across species

  • Experimental context:

    • Growth conditions and experimental setups should be optimized for each model

    • Phenotypic readouts may require different techniques in different organisms

Studies in C. elegans revealed an unexpected role for SEC-22 in RNAi efficiency, while work in fungi demonstrated its importance in development. These diverse findings suggest that while the core function in vesicular trafficking is conserved, SEC22 proteins may have acquired additional roles during evolution that should be considered when translating findings across species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.