Recombinant Human Vesicle-trafficking protein SEC22c (SEC22C)

Shipped with Ice Packs
In Stock

Description

Recombinant Production Systems

Recombinant SEC22C is produced using diverse expression platforms:

Expression SystemApplicationsPurification TagPurity
HEK-293 cells WB, SDS-PAGEHis tag >90%
Wheat germ ELISA, WBGST tag Not specified
E. coli Research assaysAviTag (biotinylated) Variable
Mammalian cells Functional studiesCustom tags >70–80%

These systems ensure proper folding and post-translational modifications critical for SEC22C’s role in membrane fusion .

Research Applications

Recombinant SEC22C is utilized in:

  • Vesicle Trafficking Assays: Studying ER-Golgi transport mechanisms .

  • Antibody Validation: Blocking experiments for specificity confirmation (e.g., antibody PA5-65957) .

  • Organelle Dynamics: Investigating ER-mitochondria contact sites and mitochondrial morphology .

  • Protein Interaction Studies: Mapping SNARE complex assembly with syntaxins and SNAP-25 homologs .

Role in Plasma Cell Function

SEC22C homolog Sec22b is essential for plasma cell survival and antibody secretion. Knockout models show:

  • 98% reduction in serum antibody titers .

  • Disrupted ER-mitochondria contacts, leading to hyperfused mitochondria and ER stress .

  • Impaired humoral immune responses post-vaccination .

Disease Associations

  • Neurodegeneration: Altered ER-Golgi trafficking linked to Alzheimer’s disease .

  • Autophagy: SEC22 family proteins regulate unconventional secretion pathways .

Challenges and Future Directions

While recombinant SEC22C enables mechanistic studies, limitations include:

  • Functional Redundancy: Overlap with Ykt6 complicates phenotype interpretation .

  • Structural Complexity: Full-length protein production requires mammalian systems for proper folding .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. If you need a particular format, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to meet your specific tag type requirements. Please inform us if you have a preference, and we will prioritize developing it during production.
Synonyms
SEC22C; SEC22L3; UNQ459/PRO784; Vesicle-trafficking protein SEC22c; SEC22 vesicle-trafficking protein homolog C; SEC22 vesicle-trafficking protein-like 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Homo sapiens (Human)
Target Names
SEC22C
Target Protein Sequence
MSVIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSI HFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQ KVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVANGVMNGHTPMHLEPAPNFR MEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFLVPFVACIFQCYL YLFYSPARTMKVVLMLLFICLGNMYLHGLRNLWQILFHIGVAFLSSYQILTRQLQEKQSD CGV
Uniprot No.

Target Background

Function
SEC22c might play a role in vesicle transport between the endoplasmic reticulum (ER) and the Golgi complex.
Gene References Into Functions
  1. These findings suggest that splicing-dependent variations in the number of transmembrane domains allow Sec22c to regulate subcellular localization in cooperation with ARF4, implying that Sec22c functions at both the Golgi and the ER. PMID: 28414125
Database Links

HGNC: 16828

OMIM: 604028

KEGG: hsa:9117

STRING: 9606.ENSP00000264454

UniGene: Hs.445892

Protein Families
Synaptobrevin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed.

Q&A

What is SEC22C and what are its fundamental cellular functions?

SEC22C (SEC22 vesicle trafficking protein homolog C) is a member of the synaptobrevin family of proteins that functions primarily in the early stages of endoplasmic reticulum (ER) to Golgi vesicle-mediated transport. As an R-SNARE protein, SEC22C assembles into protein complexes that catalyze membrane fusion events in the early secretory pathway .

The protein is primarily localized to the endoplasmic reticulum membrane and participates in SNARE complexes. Its molecular functions include SNAP receptor activity and SNARE binding, which are critical for mediating biological processes such as protein transport, exocytosis, and vesicle fusion with the Golgi apparatus. Through alternative splicing, three isoforms of human SEC22C protein are produced, allowing for functional diversity .

How can researchers effectively detect and quantify SEC22C in experimental samples?

Detection and quantification of SEC22C can be accomplished through several methodological approaches:

  • ELISA-based detection: Commercial ELISA kits are designed to detect native (not recombinant) SEC22C in various sample types including undiluted body fluids and tissue homogenates. When using ELISA approaches, researchers should ensure their assay is optimized for the specific isoform of interest .

  • Western blotting: For protein level quantification, western blotting using specific antibodies against SEC22C allows for detection of the protein in cellular lysates. This method should be preceded by proper sample preparation techniques such as detergent-based extraction to effectively solubilize this membrane protein.

  • Immunofluorescence: For localization studies, immunofluorescence microscopy using anti-SEC22C antibodies can reveal the subcellular distribution of the protein, particularly its association with ER membranes and SNARE complexes.

  • qRT-PCR: For transcript-level analysis, quantitative reverse transcription PCR can measure mRNA expression levels of SEC22C and its isoforms.

What experimental controls should be included when studying SEC22C?

When designing experiments focused on SEC22C, several controls should be incorporated:

  • Positive controls: Include samples known to express SEC22C at detectable levels, such as ER-enriched cellular fractions from tissues or cell lines with confirmed SEC22C expression.

  • Negative controls: Use samples from SEC22C knockout/knockdown models or tissues known to have minimal SEC22C expression.

  • Specificity controls: For antibody-based detection methods, include isotype controls and peptide competition assays to verify antibody specificity.

  • Isoform controls: When studying specific isoforms, include controls that can distinguish between the three known isoforms of human SEC22C produced by alternative splicing .

  • Subcellular localization controls: Include markers for the ER membrane, Golgi apparatus, and other relevant cellular compartments to confirm the expected localization patterns of SEC22C.

How do SEC22C homodimers contribute to SNARE complex formation and membrane fusion events?

Recent research has revealed that SEC22C forms homodimers that serve as dynamic intermediates necessary for efficient intracellular transport. These homodimers have been detected through cysteine cross-linking approaches when cysteine residues were positioned in the SNARE motif or C-terminus of the transmembrane domain .

The functional significance of SEC22C homodimers appears to be in promoting the assembly of higher-order SNARE complexes that catalyze membrane fusion. Experimental evidence indicates that the SEC22C transmembrane domain is required for both efficient homodimer formation and membrane fusion, suggesting a mechanistic link between these processes .

Methodologically, researchers can investigate these homodimers through:

  • Cysteine scanning approaches: Inserting cysteine residues at specific positions within the SNARE motif or transmembrane domain allows for detection of disulfide cross-linked homodimers under oxidizing conditions.

  • Temperature and time-dependent assays: Formation of SEC22C cross-linked complexes has been shown to be temperature and time dependent, providing a means to study the kinetics of these interactions.

  • Trans- vs. cis-SNARE arrangement analysis: The formation of disulfide cross-links can provide clear readouts on trans- and cis-SNARE arrangements during fusion events when specific SEC22C cysteine derivatives are present on both donor COPII vesicles and acceptor Golgi membranes .

What experimental designs are optimal for studying SEC22C's role in ER-Golgi trafficking?

When designing experiments to investigate SEC22C's function in ER-Golgi trafficking, several experimental design considerations are crucial:

  • Factorial designs: Implementing factorial experimental designs allows researchers to test multiple factors simultaneously, such as different SEC22C isoforms, interaction partners, or cellular conditions .

  • Cell-free fusion assays: These can be used to measure Golgi-specific carbohydrate modification of secretory protein substrates as an indicator of fusion events, with the rate of SEC22C-Bet1 heterodimer formation mirroring the rate of this modification .

  • Split-plot designs: For experiments requiring different levels of precision for different factors (e.g., when studying SEC22C under various cellular stresses), split-plot designs may be appropriate .

  • Independent and dependent variable selection: Carefully identify which aspects of SEC22C function (e.g., localization, dimerization, interaction with specific partners) represent dependent variables, and which experimental conditions (e.g., temperature, oxidative state, presence of trafficking inhibitors) serve as independent variables .

  • Randomization and blocking: Proper randomization of treatments and use of blocking factors are essential for controlling experimental error, especially when working with different cell lines or tissue samples .

How can researchers differentiate between the roles of different SEC22C isoforms?

Distinguishing the specific roles of the three known human SEC22C isoforms requires careful experimental approaches:

  • Isoform-specific antibodies: Development or selection of antibodies that can specifically recognize each isoform based on unique epitopes.

  • Expression constructs: Creation of tagged expression constructs for each isoform, combined with knockdown of endogenous SEC22C, allows for isoform-specific rescue experiments.

  • Domain swapping: Exchange of domains between isoforms can help identify which regions confer isoform-specific functions.

  • Mass spectrometry: Quantitative proteomics approaches can identify isoform-specific interaction partners that may explain functional differences.

  • RNA interference with isoform-specific targeting: Design of siRNAs or shRNAs that target unique exons or exon junctions to selectively deplete individual isoforms.

What cysteine cross-linking approaches are most effective for studying SEC22C protein interactions?

Cysteine cross-linking has emerged as a powerful tool for studying SEC22C interactions. The following methodological considerations should be observed:

  • Strategic cysteine placement: Cysteine residues should be inserted at specific positions within the SNARE motif or the C-terminal transmembrane segment for optimal cross-linking efficiency .

  • Oxidizing conditions: Appropriate oxidizing conditions must be established to promote disulfide bond formation without causing protein denaturation.

  • Detection methods: Western blotting under non-reducing conditions is typically used to detect cross-linked species, followed by reducing conditions to confirm the disulfide nature of the interaction.

  • Temperature and time optimization: Cross-linking reactions should be optimized for temperature and incubation time, as SEC22C homodimer formation has been shown to be both temperature and time dependent .

  • Specificity controls: Include controls with cysteine mutations at positions not expected to form cross-links to confirm the specificity of the observed interactions.

How can researchers establish appropriate in vitro systems to study SEC22C function?

Establishing effective in vitro systems for SEC22C research requires:

  • Reconstitution in liposomes: Purified recombinant SEC22C can be incorporated into artificial liposomes to study its function in a controlled membrane environment.

  • Cell-free vesicle budding and fusion assays: These systems allow for the reconstitution of ER-to-Golgi transport with defined components, enabling the specific contribution of SEC22C to be assessed .

  • Microfluidic approaches: Advanced microfluidic platforms can provide controlled environments for studying vesicle trafficking events mediated by SEC22C.

  • Donor-acceptor membrane systems: Separate preparation of donor COPII vesicles and acceptor Golgi membranes containing specific SEC22C derivatives allows for detailed analysis of trans- and cis-SNARE arrangements during fusion .

  • Fluorescence-based trafficking assays: Incorporation of fluorescently-labeled cargo proteins into trafficking pathways can provide real-time readouts of SEC22C-mediated transport.

What are the key considerations for experimental design when studying SEC22C in diverse cellular contexts?

When designing experiments to study SEC22C across different cellular systems:

  • Consider cellular variability: Different cell types may express different levels of SEC22C or its interaction partners, necessitating careful selection of experimental models .

  • Control for extraneous variables: Factors such as cell confluency, passage number, and culture conditions can affect vesicle trafficking and should be standardized .

  • Appropriate randomization: Apply randomized complete block designs or Latin square designs when testing multiple cell lines or treatments to control for batch effects and other sources of variation .

  • Sample size determination: Conduct power analyses to determine appropriate sample sizes based on expected effect sizes and variability .

  • Statistical analysis plan: Develop a comprehensive plan for data analysis, including appropriate statistical tests for comparing means (e.g., ANOVA followed by post-hoc tests like Fischer's protected LSD or Tukey's test) .

How should researchers analyze and interpret complex data from SEC22C trafficking experiments?

Analysis of SEC22C trafficking data requires rigorous approaches:

  • ANOVA frameworks: Use appropriate ANOVA models (e.g., factorial, split-plot) to analyze experimental data with multiple factors .

  • Treatment comparisons: When comparing multiple experimental conditions, apply appropriate post-hoc tests such as Fischer's F-protected LSD, Duncan's multiple range, Tukey's, Scheffe's, or Student-Newman-Keuls tests based on the experimental design and hypothesis .

  • Association analysis: Use correlation and regression analyses to determine associations between SEC22C expression/activity and trafficking outcomes .

  • Principal component analysis: For experiments generating multidimensional data, PCA can help identify patterns and reduce dimensionality .

  • Temporal dynamics: When analyzing time-course data of SEC22C-mediated trafficking, consider rates of change and time-dependent effects rather than only endpoint measurements.

What experimental approaches can reveal the dynamic nature of SEC22C interactions?

To capture the dynamic aspects of SEC22C interactions:

  • Real-time imaging techniques: Fluorescence recovery after photobleaching (FRAP), fluorescence resonance energy transfer (FRET), and other live-cell imaging approaches can reveal the kinetics of SEC22C interactions.

  • Temperature-controlled experiments: As SEC22C complex formation is temperature-dependent, varying temperature can provide insights into the energetics and kinetics of these interactions .

  • Pulse-chase experiments: These can track the movement of SEC22C through different cellular compartments over time.

  • Reversible cross-linking approaches: Using reversible cross-linkers allows for the capture of transient interactions that might be missed with permanent cross-linking methods.

  • Single-molecule tracking: Advanced microscopy techniques can follow individual SEC22C molecules to reveal heterogeneity in behavior that might be masked in bulk measurements.

Table 1: Key Properties of Human SEC22C

PropertyDescriptionReference
UniProt Entry NameSC22C_HUMAN
Chromosomal Location3p22.1
Protein TypeMembrane protein (multi-pass; integral)
Number of Isoforms3 (produced by alternative splicing)
Cellular ComponentsSNARE complex, endoplasmic reticulum membrane, integral to membrane
Molecular FunctionsSNAP receptor activity, SNARE binding
Biological ProcessesProtein transport, ER to Golgi vesicle-mediated transport, exocytosis, vesicle fusion
Protein FamilySynaptobrevin family

Table 2: Experimental Approaches for Studying SEC22C Interactions

ApproachApplicationKey ConsiderationsReference
Cysteine Cross-linkingDetection of homodimers and heterodimersRequires strategic placement of cysteine residues in SNARE motif or transmembrane domain
Cell-free Fusion AssaysMeasure membrane fusion eventsTemperature and time dependent; requires components known to function in fusion
ELISAQuantification of native SEC22CDesigned for undiluted body fluids and tissue homogenates
Trans/Cis-SNARE Arrangement AnalysisDistinguish SNARE complex topologiesRequires positioning of SEC22C cysteine derivatives on both donor and acceptor membranes
Factorial Experimental DesignTest multiple variables affecting SEC22C functionRequires proper consideration of blocking factors and randomization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.